KEGG   Bacillus subtilis subsp. subtilis 168: BSU16760
Entry
BSU16760          CDS       T00010                                 

Gene name
dapG
Definition
(RefSeq) aspartokinase 1
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00261  Monobactam biosynthesis
bsu00270  Cysteine and methionine metabolism
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01210  2-Oxocarboxylic acid metabolism
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
bsu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU16760 (dapG)
   00270 Cysteine and methionine metabolism
    BSU16760 (dapG)
   00300 Lysine biosynthesis
    BSU16760 (dapG)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU16760 (dapG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     BSU16760 (dapG)
SSDB
Motif
Pfam: AA_kinase ACT_7 ACT Glyco_trans_4_5
Other DBs
NCBI-GeneID: 936710
NCBI-ProteinID: NP_389558
Pasteur: BG10784
BSORF: BG10784
UniProt: Q04795
Position
1747123..1748337
AA seq 404 aa
MKIIVQKFGGTSVKDDKGRKLALGHIKEAISEGYKVVVVVSAMGRKGDPYATDSLLGLLY
GDQSAISPREQDLLLSCGETISSVVFTSMLLDNGVKAAALTGAQAGFLTNDQHTNAKIIE
MKPERLFSVLANHDAVVVAGFQGATEKGDTTTIGRGGSDTSAAALGAAVDAEYIDIFTDV
EGVMTADPRVVENAKPLPVVTYTEICNLAYQGAKVISPRAVEIAMQAKVPIRVRSTYSND
KGTLVTSHHSSKVGSDVFERLITGIAHVKDVTQFKVPAKIGQYNVQTEVFKAMANAGISV
DFFNITPSEIVYTVAGNKTETAQRILMDMGYDPMVTRNCAKVSAVGAGIMGVPGVTSKIV
SALSEKEIPILQSADSHTTIWVLVHEADMVPAVNALHEVFELSK
NT seq 1215 nt   +upstreamnt  +downstreamnt
gtgaagataattgttcaaaagttcggcggaacatcagtaaaagatgataaaggccgcaaa
ctggctttagggcatattaaagaagcaatcagtgaaggatataaggttgtcgttgtcgtt
tcagcgatgggccgaaaaggggacccgtatgcaacagattctttgctcgggctgctttac
ggcgatcagtcagcgatttctcctagggagcaggatttgcttttatcttgcggagagact
atttcctctgtcgtctttacaagcatgctgcttgataacggtgtgaaagcagctgcgctg
acaggggctcaggctggctttttaacgaatgatcagcatactaatgcgaaaatcattgaa
atgaaaccggagcgtttattcagtgtgctcgccaatcatgatgcggtagtcgtcgcaggc
ttccagggcgcaactgaaaagggtgatacaacaacaatcggcagagggggcagcgatacg
tctgcagccgcactcggagcagctgttgatgcggaatacatcgatattttcaccgatgta
gaaggcgtgatgactgctgacccaagagtggtagaaaatgcaaaaccgcttcctgttgtg
acgtatacggaaatctgcaacctggcgtatcagggggccaaggtcatttctccgcgtgct
gtggaaatcgcaatgcaggccaaggttccgatccgcgtccgttcgacttattcgaatgat
aaaggcacattggtgacatcacatcactcttccaaggtcggcagtgatgtttttgaaagg
ctgattacgggaatcgcccatgtcaaagatgtcacgcagttcaaagtgcctgcgaaaatc
ggccagtataacgttcagactgaagtgttcaaggctatggcaaacgctggaatcagtgtc
gatttctttaacattacacctagtgaaatcgtctatacggtagccggaaataaaacagaa
acagctcagcgtattttaatggatatgggctatgatccaatggtgacgagaaactgcgcg
aaggtatcggcggtcggcgcgggcattatgggtgttcccggtgttacgtccaaaattgta
tcggctctttcagaaaaagaaattccgatccttcagtcggctgacagccatacgacgata
tgggtgctcgtccatgaagcggatatggttcctgctgtaaacgctttgcatgaagtgttt
gaactttcgaagtaa

DBGET integrated database retrieval system