KEGG   Bacillus subtilis subsp. subtilis 168: BSU16770
Entry
BSU16770          CDS       T00010                                 

Gene name
dapA
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00261  Monobactam biosynthesis
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Module
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU16770 (dapA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BSU16770 (dapA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     BSU16770 (dapA)
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-GeneID: 939657
NCBI-ProteinID: NP_389559
Pasteur: BG10785
BSORF: BG10785
UniProt: Q04796
Position
1748368..1749240
AA seq 290 aa
MNFGNVSTAMITPFDNKGNVDFQKLSTLIDYLLKNGTDSLVVAGTTGESPTLSTEEKIAL
FEYTVKEVNGRVPVIAGTGSNNTKDSIKLTKKAEEAGVDAVMLVTPYYNKPSQEGMYQHF
KAIAAETSLPVMLYNVPGRTVASLAPETTIRLAADIPNVVAIKEASGDLEAITKIIAETP
EDFYVYSGDDALTLPILSVGGRGVVSVASHIAGTDMQQMIKNYTNGQTANAALIHQKLLP
IMKELFKAPNPAPVKTALQLRGLDVGSVRLPLVPLTEDERLSLSSTISEL
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaatttcggaaatgtgtctacagcgatgattacaccctttgacaataaagggaacgta
gactttcaaaaactgtctacactgattgattacttgttgaaaaacggaacggattcttta
gtagtagcgggaacaactggagaatctccgaccctttcaactgaagaaaaaattgcgctt
tttgaatatacggtaaaagaagtaaacggacgggtgcccgttatcgctggtactgggagc
aacaacacgaaagattccattaagctgacaaaaaaagctgaggaagcgggcgtggacgct
gttatgcttgttaccccgtattacaataaaccttctcaagaaggaatgtaccagcatttt
aaagcaattgcggcagagacatctcttccggttatgctctataatgttcctggccgtacg
gttgcttctcttgctcctgaaacgacgatccgtttggcggcagacattccgaatgtggtt
gcgattaaagaagcgagcggagacctcgaagcgattacaaaaattattgctgaaacacct
gaagacttctatgtctattcaggggatgatgctctaacgcttccaattctttcagttgga
ggtagaggagttgtgtcagtggcgagccatattgcaggcactgatatgcagcaaatgatc
aaaaattatacgaatgggcaaacagctaatgcggcactgattcatcagaaactgctgccg
attatgaaggaactgtttaaagcgcctaatcctgctccagtcaaaacagcgcttcagctg
agaggtcttgatgtcggttctgtgcgtctgcctctagtcccattaactgaggatgaacgt
ctgagcttaagcagcacgatcagcgaactgtaa

DBGET integrated database retrieval system