KEGG   Bacillus subtilis subsp. subtilis 168: BSU16799
Entry
BSU16799          CDS       T00010                                 

Gene name
ylzJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YlzJ
Other DBs
NCBI-GeneID: 8303181
NCBI-ProteinID: YP_003097729
UniProt: C0H413
Position
1751935..1752147
AA seq 70 aa
MILYTVMPQEIVFAEQNQETSAHEQIEYKGVPLLVEMKGNEAEVIQIMSTNPMHFLHPDI
SPGQKLKLNV
NT seq 213 nt   +upstreamnt  +downstreamnt
atgattctttataccgtgatgcctcaggaaattgtgtttgcagaacagaaccaagagaca
agcgcacatgagcaaattgaatataaaggtgtaccgcttctagtcgaaatgaaagggaat
gaagcggaagtcattcaaatcatgagcaccaatccaatgcattttctgcatccggacatt
tcaccgggacaaaagctgaaattaaacgtataa

DBGET integrated database retrieval system