KEGG   Bacillus subtilis subsp. subtilis 168: BSU16810
Entry
BSU16810          CDS       T00010                                 

Symbol
ymfC
Name
(RefSeq) GntR family transcriptional regulator
  KO
K03710  GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU16810 (ymfC)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU16810 (ymfC)
SSDB
Motif
Pfam: UTRA GntR HTH_DeoR HTH_11 HTH_41 HTH_24 MarR HTH_5 HTH_10 RP-C RepL HTH_20 HTH_Crp_2 Fe_dep_repress
Other DBs
NCBI-GeneID: 940138
NCBI-ProteinID: NP_389563
Pasteur: BG13423
BSORF: BG13423
UniProt: O31761 A0A6M3ZGA5
Position
1754785..1755510
AA seq 241 aa
MSTKADNRHLYLKVIERIKEDIKNGIYTEKEKLPSEFELSKKLGVSRATLREALRILEEE
HVIIRRHGVGTFVHSKPLFLSGIEQLNSVTKMIEQANMTPGTIFLSSQVLMPSEDDTKRF
HLAEGQELFYLERVRTADGQPIVYCIDKIPMNILPNSFSHQQESMFDLLEKNSGSVISYA
VTDIEPIGYHDTISPVLECDPETALLLLKQTHYDQHDKPVLYSLNYFRADKFRFHVLRKR
F
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtctacaaaagctgataatcggcacttgtatttgaaagtaattgaacgaattaaagag
gatataaaaaatgggatctacactgagaaggaaaagctgccttctgaatttgagctttcc
aaaaagcttggtgtcagcagagcgacgctaagagaagccttgcggatactggaagaagag
catgtgattatcagaaggcatggtgtaggcacttttgtccattctaagccgttatttctt
tcgggtattgaacagctgaacagtgtaaccaagatgatagaacaggcgaatatgacccct
ggcacgatttttctatcatcacaagtgcttatgccgtctgaagatgatacgaagagattt
cacttggcagaagggcaagaacttttttaccttgaacgagtcaggacagctgacggacag
ccgattgtgtattgtatagacaaaattccgatgaatattttgccgaattctttttctcat
cagcaagaatctatgtttgacctgctagagaaaaattcaggctccgtaatcagctatgca
gtaactgatatagaaccgatcggctatcacgataccatttctccagtgcttgaatgcgat
ccggaaacagctcttttgctgttaaaacaaacccattacgatcagcacgataaaccggtg
ctttattctttaaattattttagagcggataaattcagatttcatgttttgcgtaaacga
ttctaa

DBGET integrated database retrieval system