KEGG   Bacillus subtilis subsp. subtilis 168: BSU16810Help
Entry
BSU16810          CDS       T00010                                 

Gene name
ymfC
Definition
(RefSeq) GntR family transcriptional regulator
  KO
K03710  GntR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU16810 (ymfC)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    BSU16810 (ymfC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UTRA GntR HTH_DeoR HTH_41 HTH_11 HTH_24 RepL MarR HTH_5 HTH_10 HTH_20 HTH_Crp_2 Fe_dep_repress RP-C
Motif
Other DBs
NCBI-GeneID: 940138
NCBI-ProteinID: NP_389563
Pasteur: BG13423
BSORF: BG13423
UniProt: O31761
Position
1754785..1755510
Genome map
AA seq 241 aa AA seqDB search
MSTKADNRHLYLKVIERIKEDIKNGIYTEKEKLPSEFELSKKLGVSRATLREALRILEEE
HVIIRRHGVGTFVHSKPLFLSGIEQLNSVTKMIEQANMTPGTIFLSSQVLMPSEDDTKRF
HLAEGQELFYLERVRTADGQPIVYCIDKIPMNILPNSFSHQQESMFDLLEKNSGSVISYA
VTDIEPIGYHDTISPVLECDPETALLLLKQTHYDQHDKPVLYSLNYFRADKFRFHVLRKR
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctacaaaagctgataatcggcacttgtatttgaaagtaattgaacgaattaaagag
gatataaaaaatgggatctacactgagaaggaaaagctgccttctgaatttgagctttcc
aaaaagcttggtgtcagcagagcgacgctaagagaagccttgcggatactggaagaagag
catgtgattatcagaaggcatggtgtaggcacttttgtccattctaagccgttatttctt
tcgggtattgaacagctgaacagtgtaaccaagatgatagaacaggcgaatatgacccct
ggcacgatttttctatcatcacaagtgcttatgccgtctgaagatgatacgaagagattt
cacttggcagaagggcaagaacttttttaccttgaacgagtcaggacagctgacggacag
ccgattgtgtattgtatagacaaaattccgatgaatattttgccgaattctttttctcat
cagcaagaatctatgtttgacctgctagagaaaaattcaggctccgtaatcagctatgca
gtaactgatatagaaccgatcggctatcacgataccatttctccagtgcttgaatgcgat
ccggaaacagctcttttgctgttaaaacaaacccattacgatcagcacgataaaccggtg
ctttattctttaaattattttagagcggataaattcagatttcatgttttgcgtaaacga
ttctaa

DBGET integrated database retrieval system