KEGG   Bacillus subtilis subsp. subtilis 168: BSU16825
Entry
BSU16825          CDS       T00010                                 

Gene name
ymfD
Definition
(RefSeq) bacillibactin exporter
  KO
K08221  MFS transporter, ACDE family, multidrug resistance protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU16825 (ymfD)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Putative aromatic compound/drug exporter (ACDE) family [TC:2.A.1.32]
    BSU16825 (ymfD)
SSDB
Motif
Pfam: MFS_1 MFS_2 Sugar_tr MFS_3 OATP TRI12
Other DBs
NCBI-GeneID: 939662
NCBI-ProteinID: NP_389564
UniProt: O31762
Position
1755649..1756857
AA seq 402 aa
MKNIIALSSVPLVMTLGNSMLIPVLPMMEKKLSVTSFQVSLIITVYSVVAIICIPIAGYL
SDRFGRKKILLPCLLIAGLGGAVAAFASTYMKNPYAMILAGRVLQGIGSAGAAPIVMPFI
GDLFKGDDEKVSAGLGDIETANTSGKVLSPILGALLASWYWFVPFWFIPFFCLISFLLVL
FLVAKPEEDEDAPAVSEFIKSVKKIFKQDGRWLYTVFIIGCVIMFLLFGVLFYLSDTLEN
KYAIDGVAKGGLLAIPLLFLSTSSFIAGKKIGKDKGRMKFCVVTGMILLTLSFIALWWNH
SFYFLFVFLSFGGIGIGMALPALDALITEGIESEQCGTISSFYNSMRFIGVALGPPVFAA
LMSNANWIIFILSAFCSIVSLFLVLFTVDAKKSEEEKNLGTV
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaaaaatattattgcattgtcttctgtcccgcttgtgatgacactcgggaactccatg
ctgattcctgttcttccgatgatggagaaaaagctgtctgtgacttcatttcaagtatct
ttaatcattactgtatattcagtagtagcaattatttgcattccgattgccggatatttg
tcggatcgtttcgggagaaaaaaaatattgcttccatgcctcctcattgcaggattgggg
ggagccgtagctgcttttgcctcgacctatatgaaaaatccttatgctatgatcttggcg
gggcgggttcttcaaggcattggttctgcaggtgccgctccgattgtcatgccgtttatc
ggcgacctgtttaaaggagacgatgaaaaggtcagcgcgggtcttggcgatattgaaacc
gccaacacgtcagggaaggtactgagtcccatacttggagccttactggcttcttggtat
tggtttgtaccgttttggtttattccgtttttctgtttgatcagctttttgctcgtattg
tttttggtggccaagcctgaagaagatgaagatgcgcctgctgtttctgagtttattaag
agtgtgaagaaaatttttaaacaggatggtcgctggctttatacggtcttcattatcggg
tgtgtcattatgtttttgttatttggcgtattattttatttatcagatacgctggagaac
aagtatgctattgacggagtagctaaaggcggattactggcaatcccacttttgtttttg
tcaaccagttcttttatagctggcaaaaagatcggtaaagataaaggccgaatgaaattt
tgcgttgttacaggaatgattctgttaaccctttcgtttattgccttgtggtggaaccac
agtttttattttttatttgtctttttaagctttggcgggattgggattggaatggctctt
cctgctttagatgcattgataaccgaagggattgaaagtgaacaatgcggaaccatttcc
tccttttacaatagcatgcgctttataggagtagctctcggtccacctgtttttgctgca
ttaatgtctaatgcaaactggattattttcatactctcggcgttttgcagcatcgtttct
ttatttttagtgctctttactgtagatgctaaaaaaagtgaagaagaaaaaaacttaggg
acggtctag

DBGET integrated database retrieval system