KEGG   Bacillus subtilis subsp. subtilis 168: BSU16845
Entry
BSU16845          CDS       T00010                                 

Gene name
ymfF
Definition
(RefSeq) inactive metalloprotease YmfF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M16_C Peptidase_M16 G-alpha SurA_N_2
Other DBs
NCBI-GeneID: 940141
NCBI-ProteinID: NP_389566
UniProt: O31764
Position
1757037..1758317
AA seq 426 aa
MSYVNELKSKHGGLTAHIVKTEKFKTVSLIFKMLAPLTKDQVTKRALLPHVLLRGTKSHP
KTAGLRSYLDELYGTSVSADLTKKGERHVITFRLEIPNEKYLKDQTPLLEKGLQLLAELV
FSPALEGDAFQSQYVAQEKRTLKQRIQAVYDDKMRYSNLRLIQEMCKNDPYALHVNGEID
DVDDITAEQLYETYQSAIQKDQLDLYVVGDVDSNQVQSAIDKYFKTEERTLGMIENNHAD
EKVQPKEVIDEEDVKQGKLNIGYRTSITYTDQDYPALQVFNGLFGGFSHSKLFINVREKA
SLAYYAASRIESFKGLLMVMSGIEVKNFEQAVSIIAEQFQAMKNGDFSEQDIAQTKAVIR
NQVLETIDTAYGLSEFLYQQAAAQVEIPIEDFLANIENVTKEDIIKAGEKIQLDTTYFLK
GTEGAS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtcatatgttaatgaactcaaatcaaagcacggcggtttaaccgcacacattgtaaaa
acagaaaaattcaaaaccgtctcgcttatttttaagatgcttgcgccgctgacaaaggat
caagtcaccaaaagagcgcttctcccgcatgtgcttcttcgcggaacgaaaagccatccg
aaaaccgcaggattgcgttcatacttggatgagctgtacggcacgtcagtatcggctgat
cttacgaaaaaaggagagcggcatgtcattacgttcaggcttgaaatcccgaatgaaaaa
tatttaaaagaccaaacgccgcttctcgagaaagggctccagcttctcgcagaactcgtc
ttttcacctgctttggagggagacgcttttcagtcacaatatgtggctcaagaaaaacgg
acgcttaagcaaagaatccaagccgtctatgatgataaaatgcgttattcgaatttaagg
ctgatacaggaaatgtgcaaaaatgatccttacgcgcttcatgtcaatggtgaaatcgac
gatgtcgatgacattacggcagagcaattatacgaaacataccaaagcgctatccaaaaa
gaccagcttgatctatatgttgttggcgacgtggacagtaaccaggtacaatcggcaatt
gataagtatttcaaaacagaagagcgcactcttggcatgattgaaaacaatcacgctgat
gaaaaagttcagccaaaagaagtaattgatgaagaggatgtcaagcaaggaaaactgaat
atcggctaccgcaccagcatcacttatacagatcaggattatcctgctttacaagtgttt
aacggattgttcggcggattctctcattctaaacttttcattaatgttcgggaaaaagcc
agtcttgcttactacgcggcttcgcgtatagaaagttttaaaggcttgttaatggtgatg
tcaggcattgaagtgaaaaattttgaacaggcggtttcgattattgctgagcaattccag
gcaatgaaaaatggcgatttcagtgagcaggatatagcacagacaaaggccgttattcga
aatcaagtgctggaaacgattgatacagcatacggtttatctgagtttttatatcagcag
gccgctgctcaagtcgagattcctatcgaagactttcttgccaatattgagaatgtcaca
aaagaggatatcattaaagccggcgaaaagattcagcttgatacgacttatttcttaaaa
gggacggagggtgcatcttga

DBGET integrated database retrieval system