KEGG   Bacillus subtilis subsp. subtilis 168: BSU16860
Entry
BSU16860          CDS       T00010                                 

Gene name
ymfH
Definition
(RefSeq) zinc protease YmfH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M16_C Peptidase_M16
Other DBs
NCBI-GeneID: 939665
NCBI-ProteinID: NP_389568
Pasteur: BG13428
BSORF: BG13428
UniProt: O31766
Position
1758314..1759600
AA seq 428 aa
MIKPIEYEQLQETLYHEKMSNGLDVYVLPKKGFNKTYAVFTTKYGSIDNRFVPLGKNEMV
HVPDGIAHFLEHKLFEKADGDVFQDFSKQGASANAFTSFTRTAYLFSSTSNVERNLETLI
DFVQDPYFTEKTVEKEKGIIGQEINMYDDNPDWRLYFGVIENMYKEHPVRIDIAGTVESI
SHITKDLLYECYETFYHPSNMLLFIVGPVDPEAIISQVRENQGKKPYTDQPEIKREEVKE
QEAVFRKEKEIKMNVQGPKCLVGLKSKNPFKLGKELLKHELSMNLLLEALFGKSSAQYES
LYEKGYIDETFSFDFTAEYGFGFAAIGGDTPEPDQLAEDISSMLLRAGELITAEKIELAR
KKKIGTFLKALNSPEYIANQFTRYAFLDMSLFDVVTVLEQITLEDVQNVIQEEIAADRLT
VCKVVPKS
NT seq 1287 nt   +upstreamnt  +downstreamnt
ttgatcaaaccaatcgaatatgaacagcttcaggagacgctgtatcatgaaaaaatgtcc
aacggccttgatgtttacgttttgccgaaaaaaggcttcaacaagacatatgcggtcttt
acaacaaagtacggctcgatagataaccggtttgtccctttaggtaaaaacgagatggtt
cacgtgccggacgggattgctcactttcttgagcacaagctgtttgagaaagcggacgga
gacgtttttcaagatttcagcaaacagggggcttctgccaatgcgtttacgtcatttaca
agaacggcttaccttttctcaagcacatcaaatgttgaacgcaatttagagacgcttatc
gatttcgtacaggacccatattttactgaaaaaacggttgaaaaggaaaaagggattatc
gggcaggagattaatatgtacgacgataaccctgattggaggctttacttcggggtcatt
gaaaacatgtacaaagagcatcctgtcagaattgacatagcgggaacagtggaaagcatt
tcacatattacaaaagaccttctttatgaatgctatgaaacgttttatcacccgagtaac
atgctccttttcattgtcggccctgtagatcctgaagcgattatttctcaggtaagagaa
aaccaggggaaaaagccgtatactgatcagccggagatcaaacgagaagaagtgaaagag
caagaagcggttttccgaaaagaaaaagagatcaaaatgaacgtgcagggaccgaaatgc
cttgttgggctgaaatccaaaaatccgtttaaattaggcaaagagctcttaaagcatgaa
ctttcaatgaacttattgcttgaagctctttttggcaaaagctctgcccagtatgaatca
ctttatgaaaaaggatatattgacgaaacgttcagctttgattttactgctgaatatggg
ttcggttttgcggcgatcggcggagatacgcctgagcctgatcaattggctgaagacatt
tcaagcatgcttttgcgcgccggtgaactgattactgctgaaaagattgaacttgccaga
aagaaaaagatcggcacattcttaaaagcgctgaattcccctgaatacatcgccaatcaa
tttacccgttatgcgttcttggatatgagcctgtttgatgttgtaacggtactcgagcag
attaccctcgaggatgtccagaacgtaatacaagaggaaatcgctgcagacagactgact
gtctgcaaggttgttcctaaatcataa

DBGET integrated database retrieval system