KEGG   Bacillus subtilis subsp. subtilis 168: BSU16870
Entry
BSU16870          CDS       T00010                                 

Gene name
fabG
Definition
(RefSeq) oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00061  Fatty acid biosynthesis
bsu00780  Biotin metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01212  Fatty acid metabolism
Module
bsu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSU16870 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BSU16870 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BSU16870 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU16870 (fabG)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     BSU16870 (fabG)
Lipid biosynthesis proteins [BR:bsu01004]
 Fatty acid synthase
  Component type
   BSU16870 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd DUF1776 NAD_binding_10 FR47 Polysacc_synt_2
Other DBs
NCBI-GeneID: 939588
NCBI-ProteinID: NP_389569
Pasteur: BG13429
BSORF: BG13429
UniProt: O31767
Position
1759655..1760383
AA seq 242 aa
MNKTALITGASGGIGKSISETLAARGYNLLLHYNTNQNAAAELAEKLSQMFGVNAEILQA
DLSAQDGADKLTSSIVQPIDAIVLNSGRSHFGLITDVDNATVQEMVQLHVASPYMLTRNL
LPGMIRNKSGAIVAVSSIWGETGASCEVLYSMAKGAQHSFVKGLAKELAPSGIRVNAVAP
GAVDTNMMNQFTPAEKEEIADEIPIGRLARPQEIADATAFLLSEKASYITGQILSVNGGW
HC
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaacaaaacagcactaatcaccggagcaagcggcggcattggcaaaagcatcagcgaa
acccttgcagctagaggatacaatctgctgctgcattacaatacaaatcaaaacgcggca
gcggagcttgctgaaaaactaagtcagatgtttggcgtaaatgcggagatattacaagct
gacctgtccgcgcaagatggagcagataagctgacaagttcaattgttcagccgattgat
gcgattgttttaaacagcggacgaagccattttgggctgattacggatgtagataacgca
acggtccaggaaatggttcagcttcatgtggcgagtccgtatatgctgacgagaaacctt
ctgccaggcatgattcggaataaatcgggagcgattgtggctgtcagctcgatttgggga
gagactggagcatcctgtgaagtgttgtacagcatggcaaaaggagctcagcattcattt
gtaaaaggattggctaaggagctggcgccaagcggaatcagagtaaacgccgtagcgccg
ggtgcagttgatacaaatatgatgaatcaatttaccccggctgaaaaagaagagatcgct
gatgagattccgatcggccggctggcccggccgcaagaaattgcggatgcaacagctttt
ctcctgtctgaaaaagcgtcatatatcaccggccaaattctgtcggtgaatggcggctgg
cactgctga

DBGET integrated database retrieval system