KEGG   Bacillus subtilis subsp. subtilis 168: BSU16880
Entry
BSU16880          CDS       T00010                                 

Gene name
ymfJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3243
Other DBs
NCBI-GeneID: 939670
NCBI-ProteinID: NP_389570
Pasteur: BG13430
BSORF: BG13430
UniProt: O31768
Position
1760464..1760721
AA seq 85 aa
MSVLENWDSWKNFLGDRLNYAQDKGMSQDTITDLATEIGSYLANEVESKNEQEKVLADLW
SVASKDEQHAIANMMVKLVENNSTH
NT seq 258 nt   +upstreamnt  +downstreamnt
atgtcagtattagaaaactgggatagctggaaaaacttccttggcgaccgtctgaactat
gcgcaagataaaggtatgagccaggatacgattacagatcttgcgacagaaatcggcagc
tacttggctaatgaagtggaatctaagaacgagcaggaaaaagtgctggcagatctttgg
agtgtagcatcaaaagatgaacagcacgccattgccaatatgatggttaagcttgttgaa
aataacagcactcactag

DBGET integrated database retrieval system