KEGG   Bacillus subtilis subsp. subtilis 168: BSU16920
Entry
BSU16920          CDS       T00010                                 

Gene name
pgsA
Definition
(RefSeq) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU16920 (pgsA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     BSU16920 (pgsA)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 939675
NCBI-ProteinID: NP_389574
Pasteur: BG11373
BSORF: BG11373
UniProt: P46322
Position
1762623..1763204
AA seq 193 aa
MFNLPNKITLARIALIPIFMIIMLAPFDWGRLEVGDESIPVAHLAGAILFIIASTTDWVD
GYYARKLNLVTNFGKFLDPLADKLLVSAALIILVQFDLAPAWMVIVIISREFAVTGLRLV
LAGTGEVVAANMLGKIKTWAQIIAVSALLLHNLPFELVSFPFADLALWVAVFFTVVSGWE
YFSKNWEALKTSN
NT seq 582 nt   +upstreamnt  +downstreamnt
atgtttaacttaccaaataaaatcacactagctagaatcgcattaatcccaatcttcatg
attatcatgctggcgccgtttgactggggcaggctcgaagttggagacgaatccatcccg
gtcgcacatttggcgggggccattctatttattattgcatctacaacagactgggtggac
gggtattatgcccgaaaattaaatctcgtaacaaacttcgggaaatttcttgatccgctt
gcggacaaactgctcgtatccgcagcgttaattatccttgttcaatttgatctcgctcca
gcttggatggtcattgtgattatcagcagggagtttgccgtgacaggtttaaggcttgtc
ttagccggaacaggagaagtcgtagctgctaacatgcttggtaaaatcaaaacctgggca
cagattattgcggtatctgcattgcttcttcataatcttccatttgaacttgtgtcattc
ccgtttgcagacttggcgctgtgggtagccgtcttctttactgtcgtctcaggctgggaa
tatttctctaaaaattgggaagcgttaaaaacatctaactaa

DBGET integrated database retrieval system