KEGG   Bacillus subtilis subsp. subtilis 168: BSU16930
Entry
BSU16930          CDS       T00010                                 

Gene name
cinA
Definition
(RefSeq) competence-damage inducible protein
  KO
K03742  nicotinamide-nucleotide amidase [EC:3.5.1.42]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00760  Nicotinate and nicotinamide metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU16930 (cinA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.42  nicotinamide-nucleotide amidase
     BSU16930 (cinA)
SSDB
Motif
Pfam: CinA MoCF_biosynth CinA_KH
Other DBs
NCBI-GeneID: 939464
NCBI-ProteinID: NP_389575
Pasteur: BG11374
BSORF: BG11374
UniProt: P46323
Position
1763222..1764472
AA seq 416 aa
MEFPKKAEIIAVGSELLLGQIANTNAQFISKQLAEIGVNVFYHTAVGDNPERLKQVIRIA
EERSDFIIFSGGLGPTKDDLTKETIANTLGRPLVLNDEAFQSIEDYFKRTKRTMSPNNRK
QALVIEGSDVLANHFGMAPGMLTEHESRYYMLLPGPPSELRPMFENEAKPLLLKKMGSNE
KIVSTVLRFFGIGESQLEADLEDIIDAQTNPTIAPLAADGEVTLRLTAKHADEKETERLL
KETEAVILERVGEFFYGYDDTSLVKELSIACKEKGITISAAESFTGGLFSEWLTDHSGAS
KLFAGGVVCYTNDVKQNVLGVKKETLDRFGAVSKECASELAKGVQKLTGSDIGISFTGVA
GPDAQEGHEPGHVFIGISANGKEEVHEFHFAGSRTGIRKRGAKYGCHLILKLLEQK
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggaatttccaaaaaaagcagaaataattgcagtcggttcagagttgctgcttggtcaa
atcgccaatacaaatgctcaatttatcagcaaacagctcgctgaaatcggggtcaacgta
ttttatcatacagcggtcggagataacccggagcggctgaagcaggtcatccgcattgct
gaagaacgctctgacttcattattttttcaggagggcttggacccacaaaagatgatctg
acgaaagaaacgattgcaaatacgctgggacgtccgcttgtgttaaatgatgaggcattc
caatccattgaggactatttcaaacgaacaaaacgcacgatgtcacctaataaccgaaaa
caggcgcttgtgatcgaaggctctgacgtgctggcgaatcactttggaatggccccggga
atgctcacagagcatgaatcgcgctattatatgcttcttcctggaccgccgagcgaattg
cgtccaatgtttgaaaacgaggcaaagcctcttctgctgaaaaagatgggttcaaatgaa
aaaattgtgtcaactgttcttcgctttttcggtatcggtgaatctcagcttgaagccgat
ttggaagatattattgatgcacaaaccaatccgacaattgcgcctttggcggctgatgga
gaggtgacgctgcgtctgacagccaaacacgccgatgaaaaggaaacagagcgtctgtta
aaagaaacagaggccgttatcttagagcgtgtcggtgaatttttctatggttacgatgat
acttctcttgtaaaagagctatctatagcatgtaaggaaaaaggcataacaatttctgcg
gcagaaagctttaccggagggctgttttctgaatggctgacggatcatagcggtgcctca
aaattatttgccgggggcgttgtttgctatacaaacgacgtgaagcagaatgtgcttggt
gtcaagaaggaaacattagatcgttttggggcggtcagcaaggagtgcgcatccgaactg
gctaagggtgttcaaaaactcactggcagcgatatcggcattagctttactggtgtagca
ggacctgatgctcaagaagggcatgagcctgggcatgtgtttatcggcatttccgcaaat
ggtaaagaagaggttcacgagtttcactttgcgggctccagaacggggatcagaaaacgc
ggcgctaaatacggctgccatttaatcttaaagcttttagagcaaaaataa

DBGET integrated database retrieval system