KEGG   Bacillus subtilis subsp. subtilis 168: BSU16940Help
Entry
BSU16940          CDS       T00010                                 

Gene name
recA
Definition
(RefSeq) recombinase RecA
  KO
K03553  recombination protein RecA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BSU16940 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU16940 (recA)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BSU16940 (recA)
    RecFOR pathway proteins
     BSU16940 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    BSU16940 (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_24 AAA_25 AAA_16 CobU AAA PT-HINT ABC_tran DUF4116 AAA_35 LZ3wCH
Motif
Other DBs
NCBI-GeneID: 939497
NCBI-ProteinID: NP_389576
Pasteur: BG10721
BSORF: BG10721
UniProt: P16971
Position
1764645..1765691
Genome map
AA seq 348 aa AA seqDB search
MSDRQAALDMALKQIEKQFGKGSIMKLGEKTDTRISTVPSGSLALDTALGIGGYPRGRII
EVYGPESSGKTTVALHAIAEVQQQGGQAAFIDAEHALDPVYAQKLGVNIEELLLSQPDTG
EQALEIAEALVRSGAVDIVVVDSVAALVPKAEIEGDMGDSHVGLQARLMSQALRKLSGAI
NKSKTIAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGNDVMGNKT
KIKVVKNKVAPPFRTAEVDIMYGEGISKEGEIIDLGTELDIVQKSGSWYSYEEERLGQGR
ENAKQFLKENKDIMLMIQEQIREHYGLDNNGVVQQQAEETQEELEFEE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcgtcaggcagccttagatatggctcttaaacaaatagaaaaacagttcggc
aaaggttccattatgaaactgggagaaaagacagatacaagaatttctactgtaccaagc
ggctccctcgctcttgatacagcactgggaattggcggatatcctcgcggacggattatt
gaagtatacggtcctgaaagctcaggtaaaacaactgtggcgcttcatgcgattgctgaa
gttcagcagcagggcggacaagccgcgtttatcgatgcggagcatgcgttagatccggta
tacgcgcaaaagctcggtgttaacatcgaagagcttttactgtctcagcctgacacaggc
gagcaggcgcttgaaattgcggaagcattggttcgaagcggggcagttgacattgtcgtt
gtcgactctgtagccgctctcgttccgaaagcggaaattgaaggcgacatgggagattcg
catgtcggtttacaagcacgcttaatgtctcaagcgcttcgtaagctttcaggggccatt
aacaaatcgaagacaatcgcgattttcattaaccaaattcgtgaaaaagtcggtgttatg
ttcgggaacccggaaacaacacctggcggccgtgcgttgaaattctattcttccgtgcgt
cttgaagtgcgccgtgctgaacagctgaaacaaggcaacgacgtaatggggaacaaaacg
aaaatcaaagtcgtgaaaaacaaggtggctccgccgttccgtacagccgaggttgacatt
atgtacggagaaggcatttcaaaagaaggcgaaatcattgatctaggaactgaacttgat
atcgtgcaaaaaagcggttcatggtactcttatgaagaagagcgtcttggccaaggccgt
gaaaatgcaaaacaattcctgaaagaaaataaagatatcatgctgatgatccaggagcaa
attcgcgaacattacggcttggataataacggagtagtgcagcagcaagctgaagagaca
caagaagaactcgaatttgaagaataa

DBGET integrated database retrieval system