KEGG   Bacillus subtilis subsp. subtilis 168: BSU16950
Entry
BSU16950          CDS       T00010                                 

Gene name
pbpX
Definition
(RefSeq) penicillin-binding protein PbpX
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Beta-lactamase DUF4635
Other DBs
NCBI-GeneID: 939677
NCBI-ProteinID: NP_389577
Pasteur: BG12642
BSORF: BG12642
UniProt: O31773
Position
1765859..1767034
AA seq 391 aa
MTSPTRRRTAKRRRRKLNKRGKLLFGLLAVMVCITIWNALHRNSEENEPSQETAAVSNTD
QKKEVKKKTAKKSEEQIKTVDRNQKISNYLKEIGFSGTAMIVRNGEIVTNKGFGYADRKH
YIQNNPLTSFYVGSSQKALIATAILQLEEKGKLQTSDPVSTYLPHFPNGQTITLKNLLTH
TSGINGHIEGNGAITPDDLIKDIELQGIKRQPGVWDYKDSNYSVLAYIIAEVSGEPYEQY
IKNHIFKPAGMTHAGFYKTYEKEPYPAVGYKMEGSKTVTPYIPDLSQLYGAGDIYMSAID
MYKFDQALIDGKLYSQKSYEKMFTPGSSSTYGMGFYVAPGSYSNHGVMPGFNILNSFSKS
GQTIVILFSNIQNNAKLGQVNNKIYQLLNQE
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgacaagcccaacccgcagaagaactgcgaaacgcagacggagaaaactaaataaaaga
ggaaaactgttgtttggtcttttagcagtgatggtttgcattacgatttggaatgctctt
catcgaaatagtgaagaaaacgaaccatctcaagaaactgcagcggtttcaaataccgat
cagaaaaaagaggtcaaaaagaaaactgccaaaaaatcagaggaacaaatcaaaacagtg
gatcgaaaccaaaaaatcagcaattatttaaaagagatcggtttcagcggaacagccatg
attgtcagaaatggagaaatcgtaacaaataaaggttttggctatgctgaccgtaaacac
tacattcaaaataatccattgacatctttttatgtcggttcatcacaaaaagcgctgatt
gcaactgctattttgcagcttgaggaaaaggggaaacttcagacaagtgatccggtaagc
acgtatttacctcattttcccaacggacaaacgattactttgaagaatctgcttacacat
acatcggggataaacggacatattgaaggaaacggcgccattactccggacgatttaata
aaagatatagaacttcagggaatcaaacgtcagccgggcgtatgggactacaaggattcc
aactattctgttcttgcttatattattgctgaagtaagcggtgagccctatgaacagtac
ataaagaatcatatttttaaacctgcgggaatgacgcatgcaggcttttacaaaacatat
gaaaaagaaccttatcctgccgtcgggtataagatggagggcagcaaaacagttacaccg
tatatacctgatttatcccagctgtatggagcgggtgatatttatatgagcgctatagat
atgtacaaatttgaccaagcgctgatagacggaaaactgtattcgcaaaaaagctatgaa
aagatgtttacgccagggagcagctccacatacggcatgggattttatgttgctcccgga
agctattcaaaccatggtgttatgccgggcttcaatatcttgaacagctttagcaaatct
gggcaaaccattgttattttgttctcaaacattcaaaataatgctaaattgggccaagtg
aacaataaaatataccagcttctaaatcaagaatga

DBGET integrated database retrieval system