KEGG   Bacillus subtilis subsp. subtilis 168: BSU16980
Entry
BSU16980          CDS       T00010                                 

Gene name
spoVS
Definition
(RefSeq) stage V sporulation protein S
  KO
K06416  stage V sporulation protein S
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU16980 (spoVS)
SSDB
Motif
Pfam: SpoVS
Other DBs
NCBI-GeneID: 939460
NCBI-ProteinID: NP_389580
Pasteur: BG11245
BSORF: BG11245
UniProt: P45693
Position
1769935..1770195
AA seq 86 aa
MEILKVSAKSSPNSVAGALAGVLRERGAAEIQAIGAGALNQAVKAVAIARGFVAPSGVDL
ICIPAFTDIQIDGEERTAIKLIVEPR
NT seq 261 nt   +upstreamnt  +downstreamnt
atggaaatcttaaaagtttcagcaaaatcgagtccaaattcagtggcaggtgcgcttgca
ggcgtgttgagagagcgaggagccgccgagattcaagcgatcggagcgggtgcattaaac
caggctgtaaaagctgtggcgattgccaggggatttgtggcgccaagcggcgttgatttg
atttgtattccggcttttacagatattcaaatcgatggggaagaaagaacagcgattaaa
ttaatcgtggagcctcgctaa

DBGET integrated database retrieval system