KEGG   Bacillus subtilis subsp. subtilis 168: BSU16990
Entry
BSU16990          CDS       T00010                                 

Gene name
tdh
Definition
(RefSeq) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU16990 (tdh)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     BSU16990 (tdh)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C TrkA_N Methyltransf_25 HI0933_like 2-Hacid_dh_C Pyr_redox_3
Other DBs
NCBI-GeneID: 939462
NCBI-ProteinID: NP_389581
Pasteur: BG12685
BSORF: BG12685
UniProt: O31776
Position
1770461..1771504
AA seq 347 aa
MQSGKMKALMKKDGAFGAVLTEVPIPEIDKHEVLIKVKAASICGTDVHIYNWDQWARQRI
KTPYVFGHEFSGIVEGVGENVSSVKVGEYVSAETHIVCGECVPCLTGKSHVCTNTAIIGV
DTAGCFAEYVKVPADNIWRNPADMDPSIASIQEPLGNAVHTVLESQPAGGTTAVIGCGPI
GLMAVAVAKAAGASQVIAIDKNEYRLRLAKQMGATCTVSIEKEDPLKIVSALTSGEGADL
VCEMSGHPSAIAQGLAMAANGGRFHILSLPEHPVTIDLTNKVVFKGLTIQGITGRKMFST
WRQVSQLISSNMIDLAPVITHQFPLEEFEKGFELMRSGQCGKVILIP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgcagagtggaaagatgaaagctctaatgaaaaaggacggggcgttcggtgctgtgctg
actgaagttcccattcctgagattgataaacatgaagtcctcataaaagtgaaagccgct
tccatatgcggcacggatgtccacatttataattgggatcaatgggcacgtcagagaatc
aaaacaccctatgttttcggccatgagttcagcggcatcgtagagggcgtgggagagaat
gtcagcagtgtaaaagtgggagagtatgtgtctgcggaaacacacattgtctgtggtgaa
tgtgtcccttgcctaacaggaaaatctcatgtgtgtaccaatactgctataatcggagtg
gacacggcaggctgttttgcggagtatgtaaaagttccagctgataacatttggagaaat
cccgctgatatggacccgtcgattgcttccattcaagagcctttaggaaatgcagttcat
accgtactcgagagccagcctgcaggaggaacgactgcagtcattggatgcggaccgatt
ggtcttatggctgttgcggttgcaaaagcagcaggagcttctcaggtgatagcgattgat
aagaatgaatacaggctgaggcttgcaaaacaaatgggagcgacttgtactgtttctatt
gaaaaagaagacccgctcaaaattgtaagcgctttaacgagtggagaaggagcagatctt
gtttgtgagatgtcgggccatccctcagcgattgcccaaggtcttgcgatggctgcgaat
ggcggaagatttcatattctcagcttgccggaacatccggtgacaattgatttgacgaat
aaagtggtatttaaagggcttaccatccaaggaatcacaggaagaaaaatgttttcaaca
tggcgccaggtgtctcagttgatcagttcaaacatgatcgatcttgcacctgttattacc
catcagtttccattagaggagtttgaaaaaggtttcgaactgatgagaagcgggcagtgc
ggaaaagtaattttaattccataa

DBGET integrated database retrieval system