KEGG   Bacillus subtilis subsp. subtilis 168: BSU17000
Entry
BSU17000          CDS       T00010                                 

Gene name
kbl
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00639  glycine C-acetyltransferase [EC:2.3.1.29]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU17000 (kbl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU17000 (kbl)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.29  glycine C-acetyltransferase
     BSU17000 (kbl)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class II
   BSU17000 (kbl)
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 SHMT OKR_DC_1 Beta_elim_lyase
Other DBs
NCBI-GeneID: 939651
NCBI-ProteinID: NP_389582
Pasteur: BG12610
BSORF: BG12610
UniProt: O31777
Position
1771517..1772695
AA seq 392 aa
MTKEFEFLKAELNSMKENHTWQDIKQLESMQGPSVTVNHQKVIQLSSNNYLGFTSHPRLI
NAAQEAVQQYGAGTGSVRTIAGTFTMHQELEKKLAAFKKTEAALVFQSGFTTNQGVLSSI
LSKEDIVISDELNHASIIDGIRLTKADKKVYQHVNMSDLERVLRKSMNYRMRLIVTDGVF
SMDGNIAPLPDIVELAEKYDAFVMVDDAHASGVLGENGRGTVNHFGLDGRVHIQVGTLSK
AIGVLGGYAAGSKVLIDYLRHKGRPFLFSTSHPPAVTAACMEAIDVLLEEPEHMERLWEN
TAYFKAMLVKMGLTLTKSETPILPILIGDEGVAKQFSDQLLSRGVFAQSIVFPTVAKGKA
RIRTIITAEHTKDELDQALDVIEKTAKELQLL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgacgaaggaatttgagtttttaaaagcagagcttaatagtatgaaagaaaaccataca
tggcaagacataaaacagcttgaatctatgcagggcccatctgtcacagtgaatcaccaa
aaagtcattcagctatcttctaataattacctcggattcacttcacatcctagactcatc
aacgccgcacaggaggccgttcagcagtatggagccggcaccggatcagtgagaacgatt
gcgggtacatttacaatgcatcaagagcttgagaaaaagctggcagcctttaaaaaaacg
gaggcggcacttgtattccaatcaggcttcacaacaaaccaaggcgtactttcaagtatt
ctatcaaaagaggacattgtcatctcagatgaattgaaccatgcctctattattgacgga
attcgactgacaaaggcggataaaaaggtgtatcagcacgtcaatatgagtgatttagag
cgggtgctgagaaagtcaatgaattatcggatgcgtctgattgtgacagacggcgtattt
tccatggatggcaacatagctcctctgcctgatattgtagagctcgctgagaaatatgac
gcatttgtgatggtggatgacgcccatgcatccggagtacttggcgaaaacggcagggga
acggtgaatcacttcggtcttgacggcagagtgcatattcaggtcggaacattaagcaag
gcaatcggagtgctcggcggctacgctgcaggttcaaaggtgctgatcgattatttgcgc
cataaaggccgtccatttttattcagcacatctcatccgccggcagtcactgcagcttgt
atggaagcgattgatgtcttgcttgaagagccggagcatatggagcgcttgtgggagaat
actgcctattttaaagcaatgcttgtgaaaatgggtctgactctcacgaagagtgaaacg
ccgattcttcctattttaataggtgatgaaggtgtggcaaagcaattttcagatcagctc
ctttctcgcggtgtttttgcccaaagtatcgttttcccgactgtagcaaagggaaaagcc
agaattcgcacgattataacagcagagcacaccaaagatgaactggatcaggcgcttgat
gtcatcgaaaagacggcaaaggagctccagctattgtaa

DBGET integrated database retrieval system