KEGG   Bacillus subtilis subsp. subtilis 168: BSU17010
Entry
BSU17010          CDS       T00010                                 

Gene name
ymcB
Definition
(RefSeq) (dimethylallyl)adenosine tRNA methylthiotransferase MiaB
  KO
K06168  tRNA-2-methylthio-N6-dimethylallyladenosine synthase [EC:2.8.4.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU17010 (ymcB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.3  tRNA-2-methylthio-N6-dimethylallyladenosine synthase
     BSU17010 (ymcB)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  tRNA modification factors
   Methylthiotransferases
    BSU17010 (ymcB)
SSDB
Motif
Pfam: Radical_SAM UPF0004 TRAM TRAM_2
Other DBs
NCBI-GeneID: 939451
NCBI-ProteinID: NP_389583
Pasteur: BG13418
BSORF: BG13418
UniProt: O31778
Position
1772843..1774372
AA seq 509 aa
MNEKQKLESGQVHPSDKKSEKDYSKYFEAVYIPPSLKDAKKRGKEAVTYHNDFKISEQFK
GLGDGRKFYIRTYGCQMNEHDTEVMAGIFMALGYEATNSVDDANVILLNTCAIRENAENK
VFGELGHLKALKKNNPDLILGVCGCMSQEESVVNRILKKHPFVDMIFGTHNIHRLPELLS
EAYLSKEMVVEVWSKEGDVIENLPKVRNGKIKGWVNIMYGCDKFCTYCIVPYTRGKERSR
RPEDIIQEVRRLASEGYKEITLLGQNVNAYGKDFEDMTYGLGDLMDELRKIDIPRIRFTT
SHPRDFDDRLIEVLAKGGNLLDHIHLPVQSGSSEVLKLMARKYDRERYMELVRKIKEAMP
NASLTTDIIVGFPNETDEQFEETLSLYREVEFDSAYTFIYSPREGTPAAKMKDNVPMRVK
KERLQRLNALVNEISAKKMKEYEGKVVEVLVEGESKNNPDILAGYTEKSKLVNFKGPKEA
IGKIVRVKIQQAKTWSLDGEMVGEAIEVK
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgaatgaaaaacaaaaattagagagcggacaagttcatccatcggacaaaaaatccgag
aaggattacagcaagtactttgaagctgtttacattccgccttctttaaaagacgcgaaa
aaacgaggcaaggaagccgttacttatcataatgactttaaaatttctgaacaatttaaa
ggattgggagacggaagaaagttctatatccgtacgtacggctgccaaatgaatgaacac
gatacagaggttatggcagggatctttatggcgctcggttacgaagcgacaaactctgtt
gacgatgccaatgtcattttgttaaatacatgtgcaatccgtgaaaatgctgaaaacaag
gtgtttggtgagctcgggcacttaaaagcactgaaaaaaaacaatcccgatctgatttta
ggcgtgtgcggctgtatgtcccaagaggaatcagtcgtgaaccgtattttgaaaaaacat
ccgtttgtcgatatgattttcggaacgcataacattcatcgcctgccggagcttttgtca
gaagcatacctttcaaaagaaatggttgtagaagtttggtctaaggaaggggacgttatt
gaaaaccttccaaaagtccgaaatggaaaaattaagggctgggtcaatatcatgtacggc
tgtgacaaattctgtacgtattgcattgtgccttacacacgcggaaaagaaagaagccgc
cgccctgaggatatcattcaggaagtgagaaggctcgcaagtgaaggctataaggaaatt
actctgttaggccaaaacgtaaacgcgtatggaaaagactttgaagatatgacgtacgga
cttggtgatttgatggatgaactgagaaaaatcgatatcccgagaatccgttttacaacg
agtcatccgcgcgactttgacgaccgcctcattgaagtgctggcaaaaggcggaaatctg
cttgatcacattcatcttccggttcaatcaggaagctcagaagttctcaagctgatggcc
cgcaaatatgacagagagcgttacatggagctggtgcgaaaaattaaagaagcaatgcca
aacgcttctttgacaacggacattatcgtcggatttccaaatgaaacggacgaacagttt
gaagaaacgctttctctataccgtgaagtggagtttgacagcgcctatacgttcatttac
tctccgcgtgaaggcactccggctgctaagatgaaagataatgtaccgatgcgtgtgaaa
aaagaacgcctgcagcgtctaaacgcactggtgaatgaaatttctgctaaaaaaatgaag
gaatacgaaggcaaggttgtcgaagtattagttgagggtgaaagcaaaaataaccctgat
attcttgctggctatactgaaaaaagcaagcttgtcaatttcaaagggccgaaggaagcc
atcggcaaaatcgtccgcgtgaaaatccagcaagcgaaaacatggtcgcttgacggagaa
atggtaggagaagcaatcgaggtgaaatga

DBGET integrated database retrieval system