KEGG   Bacillus subtilis subsp. subtilis 168: BSU17020
Entry
BSU17020          CDS       T00010                                 

Gene name
ymcA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Com_YlbF CREPT Mu-like_Pro Histone_HNS DUF1454 DUF2452 cwf21 PCRF FlxA DUF244 ABC_tran_CTD DUF2209 SPT16
Other DBs
NCBI-GeneID: 939581
NCBI-ProteinID: NP_389584
Pasteur: BG13417
BSORF: BG13417
UniProt: O31779
Structure
PDB: 
6PRH 2PIH 6PRK

Position
1774374..1774805
AA seq 143 aa
MTLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLK
HYEKHEALKQVEAKIDALQEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITS
TGGDLLKGETGSKVKHSNNSCSL
NT seq 432 nt   +upstreamnt  +downstreamnt
atgacgctctactcaaaaaaagacattgtgcagcaggctcgaaaccttgcaaaaatgatt
tctgaaacagaagaggttgattttttcaaacgggctgaagcgcaaatcaatgagaatgac
aaagtgtccacaatcgttaatcagattaaagccctgcaaaagcaggctgtcaatctgaag
cattatgaaaagcatgaagcgctcaaacaagtagaagcaaaaattgacgcgctgcaagaa
gagcttgaagagattcctgttatccaggaattcagagactcgcaaatggaagtaaatgac
ctactgcagctcgttgcacacaccatttccaaccaagtcacaaatgaaatcatcacatca
accggaggcgacctgctgaaaggggaaaccggttcaaaggtgaagcattcaaataacagc
tgttctctctaa

DBGET integrated database retrieval system