KEGG   Bacillus subtilis subsp. subtilis 168: BSU17030
Entry
BSU17030          CDS       T00010                                 

Symbol
cotE
Name
(RefSeq) spore coat protein E
  KO
K06328  spore coat protein E
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU17030 (cotE)
SSDB
Motif
Pfam: CotE
Other DBs
NCBI-GeneID: 939508
NCBI-ProteinID: NP_389585
Pasteur: BG10494
BSORF: BG10494
UniProt: P14016 A0A6M4JGW7
Position
1775067..1775612
AA seq 181 aa
MSEYREIITKAVVAKGRKFTQCTNTISPEKKPSSILGGWIINHKYDAEKIGKTVEIEGYY
DINVWYSYADNTKTEVVTERVKYVDVIKLRYRDNNYLDDEHEVIAKVLQQPNCLEVTISP
NGNKIVVQAEREFLAEVVGETKVVVEVNPDWEEDDEEDWEDELDEELEDINPEFLVGDPE
E
NT seq 546 nt   +upstreamnt  +downstreamnt
atgtctgaatacagggaaattattacgaaggcagtagtagcgaaaggccgaaaattcacc
caatgcaccaacaccatctcgcctgagaaaaaaccgagcagcattttgggtggttggatt
attaaccacaagtatgacgctgaaaaaattggaaaaacggtagaaattgaagggtattat
gatataaacgtatggtactcttacgcggacaacacaaagacagaggttgtcacagaacgg
gtaaaatatgtagatgtcattaaactcagatacagagacaataattacttagatgatgag
catgaagtgattgccaaagtgcttcagcagccaaactgccttgaagtgaccatttcgccg
aatggaaataaaatcgttgtgcaggcagaaagagaatttttggcggaagtggtaggggaa
acaaaggtagttgttgaggtcaatcctgactgggaagaggatgacgaggaagattgggaa
gatgagcttgatgaagagcttgaagacatcaacccggagtttttagtgggagatcctgaa
gaataa

DBGET integrated database retrieval system