KEGG   Bacillus subtilis subsp. subtilis 168: BSU17050
Entry
BSU17050          CDS       T00010                                 

Gene name
mutL
Definition
(RefSeq) DNA mismatch repair protein MutL
  KO
K03572  DNA mismatch repair protein MutL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    BSU17050 (mutL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU17050 (mutL)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Molecular matchmaker
     BSU17050 (mutL)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 939455
NCBI-ProteinID: NP_389587
Pasteur: BG11402
BSORF: BG11402
UniProt: P49850
Structure
PDB: 
3KDG 3KDK 3GAB

Position
1778337..1780220
AA seq 627 aa
MAKVIQLSDELSNKIAAGEVVERPASVVKELVENAIDADSTVIEIDIEEAGLASIRVLDN
GEGMENEDCKRAFRRHATSKIKDENDLFRVRTLGFRGEALPSIASVSHLEITTSTGEGAG
TKLVLQGGNIISESRSSSRKGTEIVVSNLFFNTPARLKYMKTVHTELGNITDVVNRIALA
HPEVSIRLRHHGKNLLQTNGNGDVRHVLAAIYGTAVAKKMLPLHVSSLDFEVKGYIALPE
ITRASRNYMSSVVNGRYIKNFPLVKAVHEGYHTLLPIGRHPITFIEITMDPILVDVNVHP
SKLEVRLSKETELHDLIRDGIKDVFKQQQLIPSAQVPKKSAPAIKNEQQFITFDEKPPEK
KVPEKSTAPSYSPMKLSSVVKEPVDAEEKLPPLQFDAPPIVDQEQTLEVSDVSAEQPETF
EQECHEEQPQPASDRVPIMYPIGQMHGTYILAQNENGLYIIDQHAAQERIKYEYFREKVG
EVEPEVQEMIVPLTFHYSTNEALIIEQHKQELESVGVFLESFGSNSYIVRCHPAWFPKGE
EAELIEEIIQQVLDSKNIDIKKLREEAAIMMSCKGSIKANRHLRNDEIKALLDDLRSTSD
PFTCPHGRPIIIHHSTYEMEKMFKRVM
NT seq 1884 nt   +upstreamnt  +downstreamnt
gtggcaaaagtcatccaactgtcagatgagctttcaaataaaatagcggcgggcgaggtt
gtggaacggcccgcctcagtcgtcaaagaattggtggaaaatgcgatcgacgctgacagc
acagtcattgaaatcgatattgaggaagcaggccttgcatccattcgggtcttggataac
ggcgaaggaatggagaatgaagattgcaagcgagctttccggcgccacgcaacgagtaaa
ataaaagatgaaaatgatttattcagggtgagaacgctcggtttcaggggagaagccctg
ccgagtatcgcgtcagtctctcatctggagattacaacaagcactggtgaaggagctggg
acgaagctcgtcctccaaggaggaaacatcatttccgaatcgcgttcctcaagcaggaag
ggaactgaaattgtcgtttccaacctgttttttaacacaccggcccgtttgaaatatatg
aaaaccgttcatacagagcttggaaacattacagatgtggttaaccgtattgctctggcg
catccagaggtatcgatccgcctgcgccatcatgggaaaaacctgcttcaaacgaacgga
aacggagatgtgcgccatgtactggcagcgatttacggcacggctgtcgccaaaaaaatg
cttccgctgcatgtgagctccttggattttgaagtaaagggatatatcgccctcccagag
attacacgggcgtcgagaaactatatgtcgtctgtggtcaatggccgttacattaaaaat
ttcccgctcgtcaaagcggttcatgaaggctatcatacgcttctgccgatcggacgccat
ccgattacttttatagaaattacgatggacccgattttagtcgatgtcaacgtgcatcca
tcgaagcttgaggtccggctcagcaaggaaacagagcttcatgacttaatacgtgacgga
attaaagatgtgtttaaacagcagcagctgattcctagtgcccaggtcccgaaaaaatca
gcacctgccatcaaaaatgagcagcagtttataacctttgatgaaaagcctccggaaaaa
aaagttccggaaaaatcgactgcgccatcttattcaccgatgaagctcagctcagtcgta
aaagagccggttgatgcggaggaaaaattgccccctctccaatttgatgctcctcctatc
gttgatcaggaacaaacccttgaggtgtccgatgtttcagcagaacagcctgaaacattt
gagcaggaatgccatgaggaacagccgcagccagcgtctgatcgggttccaattatgtac
ccgattggccagatgcacgggacttatatattggcacaaaacgaaaacggcctatatatt
atcgaccagcacgccgcccaagaacgtattaaatatgagtacttccgtgaaaaggtgggg
gaggttgagcctgaggtgcaggagatgattgtaccgctgacgttccactactccacaaat
gaggctttgattattgaacagcacaaacaagagctcgaaagcgtcggtgtctttttagag
tcattcggctctaacagttacatcgtccgctgccacccagcctggtttccaaagggagaa
gaagcagagcttatagaagaaatcattcagcaggtgctcgactccaaaaatatagatatt
aaaaaacttcgcgaggaagcggcgattatgatgagctgcaaaggctccatcaaagcaaat
cgccacctcagaaacgacgaaatcaaagcgcttctggacgacctccgaagcacatcagac
ccatttacatgcccgcacggccgcccgatcatcattcaccactcgacatatgagatggaa
aagatgttcaaacgcgtgatgtag

DBGET integrated database retrieval system