KEGG   Bacillus subtilis subsp. subtilis 168: BSU17060
Entry
BSU17060          CDS       T00010                                 

Gene name
ymzD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YrvL SAUGI
Other DBs
NCBI-GeneID: 2914256
NCBI-ProteinID: YP_054578
Pasteur: BG14188
BSORF: BG14188
UniProt: Q7WY71
Position
complement(1780618..1781073)
AA seq 151 aa
MNQKEQNEHSKDFNLRSKLIGIVSITFIAAIALAVIFGGFFFGMKGLFSILGITYASNQT
LALFILACFAVGLIIDPLTKIISIILAKSLSLKKTALFAFILYFISNLITICFADYFMQS
IYIPDVLLVVISAFMAIIELAFDNQPNREAA
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaccaaaaagaacagaacgagcactctaaagattttaacctgagatcaaaattaatc
ggaattgtatctattacttttatcgcggccatcgcgcttgcagtcatcttcggcggcttt
ttcttcgggatgaaaggcttattctccatacttggcatcacatacgcttccaatcaaaca
ttagctttatttattttagcctgctttgctgtaggtttaatcatagacccactcacaaag
attatctctatcattttggcaaaatcactttcattgaaaaagactgcactttttgctttt
atactgtattttatcagcaatcttataacgatctgttttgcagattactttatgcagtct
atttatattccagatgtcttgcttgttgtgatatcagctttcatggctatcattgaactt
gcttttgataaccagcctaatagagaagcagcttaa

DBGET integrated database retrieval system