KEGG   Bacillus subtilis subsp. subtilis 168: BSU17070
Entry
BSU17070          CDS       T00010                                 

Gene name
ymcC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UcrQ DUF2070
Other DBs
NCBI-GeneID: 939511
NCBI-ProteinID: NP_389588
Pasteur: BG13419
BSORF: BG13419
UniProt: O31780
Position
complement(1781228..1781785)
AA seq 185 aa
MNGIAWMIVFCEIAFWVVIVLGLAVRYVFKRHTLGLLFLALTPVIDLILLAATGVDLYRG
ASATAAHGIAAVYIGISIAYGKQMIQWADEKFQYYVTKKGTKPLKRFGMDHAKHGAKGWL
RHVLAYLIGAGLLAGMIYFINDSSRTEALSGILKLWTVIIGIDFLITASYFIWPKKEKAS
ANLRS
NT seq 558 nt   +upstreamnt  +downstreamnt
ttgaacggtatcgcatggatgattgttttctgtgaaattgcgttttgggttgtcattgtt
ttggggcttgctgtacgctacgtattcaaacgacatacattaggactgctattccttgcc
ttaactccagttatcgatttgatcttgttagcggcaactggtgtggacctttaccgcgga
gcctcagcgaccgcagcccatgggattgcagctgtttacatcggtatatcgatcgcttat
gggaaacaaatgattcaatgggcagatgaaaagtttcaatattatgtgacaaaaaaagga
acaaaaccgctgaaacgttttggaatggaccatgccaagcacggtgcgaaaggctggcta
agacatgtgctggcctacttaattggtgcgggactattggcagggatgatctattttatc
aatgactcttcccgaaccgaggcgttgagcggcattcttaaactgtggactgtcattata
ggcattgactttctcattacagccagctattttatttggccaaaaaaagagaaagcttcg
gcgaatctcaggagttaa

DBGET integrated database retrieval system