KEGG   Bacillus subtilis subsp. subtilis 168: BSU17080
Entry
BSU17080          CDS       T00010                                 

Gene name
pksA
Definition
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_C_6 TetR_N TetR_C_31
Other DBs
NCBI-GeneID: 939593
NCBI-ProteinID: NP_389589
Pasteur: BG12647
BSORF: BG12647
UniProt: O34381
Position
1781906..1782523
AA seq 205 aa
MPKQIDHEKRRKQIAEATWRVILERGMEGASARNIAKEAGLSLGALRHYFSTQDELLAFA
MKLVQEKVTDRIKDIAVRDLLPKEKVLQILLEMVPTNEETIREMEVWFAFTAYARHKKDM
FDASHDGIFSGMRNLIAYLDESDLLKQNADKDIEAERLYALVDGLALHAMLDPVRVNKDR
IKRVIMQHVESICVEDTRETQKRHP
NT seq 618 nt   +upstreamnt  +downstreamnt
atgccaaaacaaattgaccatgagaaaagaagaaaacaaattgcagaagcaacgtggcgc
gtcattttagaacgagggatggagggagcatcagccagaaatattgcaaaggaagcagga
ttgtcattaggtgcgctgcgccattatttctctacacaggatgaattgcttgcttttgca
atgaaacttgtccaagaaaaggtaacggaccgaattaaggacattgcagtgagggatttg
ctccctaaggaaaaagtgttgcaaattttgcttgaaatggtcccaacgaatgaagaaacg
attagagagatggaggtttggtttgcttttactgcttacgccagacataaaaaggatatg
tttgatgcgagtcatgacgggattttcagcggcatgcggaatctgattgcctatttagat
gaatccgatttactgaagcagaatgctgataaagacattgaagctgagagactttacgcg
cttgttgacggcttggctttacatgccatgcttgaccctgtgcgcgtgaataaagaccga
atcaagcgggtcattatgcagcatgtagagtcaatttgcgtggaagatacacgtgagaca
caaaaacgacatccttaa

DBGET integrated database retrieval system