KEGG   Bacillus subtilis subsp. subtilis 168: BSU17090
Entry
BSU17090          CDS       T00010                                 

Gene name
pksB
Definition
(RefSeq) polyketide biosynthesis zinc-dependent hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2 Lactamase_B_3
Other DBs
NCBI-GeneID: 939445
NCBI-ProteinID: NP_389590
Pasteur: BG12648
BSORF: BG12648
UniProt: O34769
Position
1782713..1783390
AA seq 225 aa
MNLTYKVHPIKTRYQGWTNYCYIIEDIVSRSAIVVDPSWELSKITTTLSELEAELKAVAL
THSHYDHVNLVDPLTKMFNAQVYMSKKEIDYYQFRCRNLISLDDHQTISIGNTRAQCLLT
PGHTAGGMCYLFSESIFTGDTVFTEGCGICEDDGSSAEEMFDSIQRIKSEVSPHVRVYPG
HSFGKSPGHSIKDLYQHNIYFQIDKKEYFVKFRTRKNQKGIFDFK
NT seq 678 nt   +upstreamnt  +downstreamnt
atgaatcttacttacaaggtgcatccaattaaaacaaggtatcagggctggacgaattat
tgctatatcattgaagatattgtaagcagatctgcaattgttgttgatccctcatgggaa
ttgagtaagataaccactacactttccgaactcgaagcggaattaaaggcagtcgcattg
acacactctcattatgatcatgtaaatctggtagacccgctgacgaagatgtttaacgct
caagtttatatgtcgaaaaaagaaattgattattatcaattccgatgcagaaatttaatt
agcctagatgatcatcagacgatcagcataggaaacacaagagcacagtgccttctcaca
ccggggcatacagccggcggaatgtgttatttgttttctgagagtatttttaccggagat
acggtgtttacagaagggtgcggcatatgtgaggatgatggcagctctgcggaagagatg
tttgatagcattcaaagaataaagtcggaggtttcaccccatgtacgggtgtatcctggt
cactcatttggcaaatcgcccggccattcgataaaggatctttatcagcataatatttac
tttcaaattgataagaaagaatattttgtgaaatttcgcactcgtaaaaaccaaaaaggt
atttttgattttaaataa

DBGET integrated database retrieval system