KEGG   Bacillus subtilis subsp. subtilis 168: BSU17100Help
Entry
BSU17100          CDS       T00010                                 

Gene name
pksC
Definition
(RefSeq) polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC
  KO
K15327  polyketide biosynthesis malonyl-CoA-[acyl-carrier-protein] transacylase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17100 (pksC)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  beta-Branched incorporating proteins
   BSU17100 (pksC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1 DUF2974
Motif
Other DBs
NCBI-GeneID: 939504
NCBI-ProteinID: NP_389591
Pasteur: BG12649
BSORF: BG12649
UniProt: O34825
Structure
PDB: 

Position
1783763..1784629
Genome map
AA seq 288 aa AA seqDB search
MITYVFPGQGSQKQGMGSGLFDEFKELTDQADEILGYSIKRLCLENPYSNLNKTQFTQPA
LYVVNALSYLKKIRDEEVKPDFVAGHSLGEYNALFAAEAFDFETGLQLVRKRGELMSLIS
NGGMAAVMGLNEEQVAKALKEYHLHDVDIANVNAPYQIVISGKKDEIEKAASLFETMTEV
TMVLPLNVSGAFHSRYMNKAKEEFEEFLHAFYFSPPSIPVISNVYAKPYTYEFMKQTLAD
QINHSVKWTDSISYLMKKGHMEFEEVGPGNVLTGLIHRIKKDAEAMPR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatcacatatgtttttccaggtcagggttcacaaaaacagggaatgggcagcggccta
ttcgatgaatttaaagaactgacggatcaggcagatgagatcttaggatattctatcaaa
cgtctttgcctggaaaatccttattccaatttaaacaaaacgcaatttactcagccggca
ttatatgtggtaaacgcactaagctatctgaaaaaaatcagggatgaagaagttaaacct
gactttgtcgccgggcacagcttgggtgaatacaatgcgttatttgcagctgaagccttt
gattttgagacaggtttacagcttgtcagaaaaagaggcgagctgatgagtctgataagc
aacggcggtatggcagctgttatgggactaaatgaagagcaggttgcaaaggctctgaaa
gaatatcatttacatgatgttgatatcgctaatgtgaatgccccatatcaaattgtaatt
tcaggaaaaaaagatgagattgaaaaagccgcatctctttttgaaacgatgactgaagtt
acaatggtactccccttaaacgtaagcggcgcgtttcattccagatacatgaataaagca
aaagaagaattcgaggagttccttcatgccttttatttttcgcctccgtctatcccggtt
atttctaatgtgtatgccaaaccgtatacatacgaattcatgaaacagacgctggctgat
caaattaatcattcagtgaaatggactgacagcataagctacttaatgaaaaaaggccat
atggagtttgaggaggtagggcctggaaatgttttaactgggttaattcatcgcataaag
aaagatgcggaagcaatgccccgctaa

DBGET integrated database retrieval system