KEGG   Bacillus subtilis subsp. subtilis 168: BSU17110
Entry
BSU17110          CDS       T00010                                 

Gene name
pksD
Definition
(RefSeq) polyketide biosynthesis acyltransferase homolog PksD
  KO
K15328  bacillaene synthase trans-acting acyltransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17110 (pksD)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   trans-AT PKS
    Bacillaene PksX synthase
     BSU17110 (pksD)
SSDB
Motif
Pfam: Acyl_transf_1 SAT
Other DBs
NCBI-GeneID: 939463
NCBI-ProteinID: NP_389592
Pasteur: BG12650
BSORF: BG12650
UniProt: O34877
Position
1785133..1786107
AA seq 324 aa
MNEPLVFMFSGQGSQYYHMGKELFKENTVFRQSMLEMDAIAARRIGTSIVEEIYHPGKRV
SDPFDSILFSHPAIFMIEYSLYKVLEDRGIYPDYVLGSSLGEFAAAAVSGVSDAEDMLDC
ILEQAIIIQNSCDKGKMLAILDKPQLLNDHPQLFGNSELISINYDSHFVISGEEDHIRKI
MEDLKEKQILCQLLPVSYAFHSSLIDPAESAYAEFLRSKSFQKPSIPIVSSLTGSCLHVM
DENFFWNAVRKPMMFREAIRYLESQHTCKFIDLGPSGTLAAFVKQLIPGDSADRCCSIIT
PFHQELKNLNTVEYFRTPERKFTR
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaatgaaccgcttgtttttatgttttccgggcaaggttcccaatactatcacatgggg
aaagaactatttaaggaaaataccgtgtttcgccaatcaatgcttgaaatggatgccatt
gcagcacggcgaatcggcacatccattgttgaagaaatctaccatccaggtaaacgtgtg
tcagatccgtttgacagtattcttttttcccaccccgccatttttatgattgagtattcc
ttatataaggttttggaagacaggggaatttatcctgattacgtattgggatcaagtctg
ggagaattcgcagcagcggcagtttctggtgtgtcagacgcagaggatatgctggattgc
atacttgaacaggctattatcatccagaattcctgcgataaaggaaaaatgctggccatt
cttgacaaaccgcaattgctgaatgatcatccgcaactgtttggaaatagtgaactcatt
tctatcaattatgattcgcacttcgtcatttctggtgaagaagatcatataaggaagatt
atggaggatttaaaggagaagcagattctttgccagctgcttcctgtgtcctatgccttt
cattcttcgcttattgatccggcagagagtgcctatgcagaatttttaagatcaaaatct
tttcaaaaaccgtcaataccgattgtatcgagcttaacgggaagctgccttcacgtaatg
gacgagaatttcttttggaatgcggtcagaaagccaatgatgtttcgtgaagcgattcga
tatttggaaagccagcatacatgcaagtttatcgatttagggccatccggcaccttagct
gcttttgtgaaacagctgattccgggtgattcagctgaccgttgctgctcaatcataaca
ccatttcatcaggagctgaaaaatctgaatacggttgagtatttccgtacaccagaaagg
aagtttacaagatga

DBGET integrated database retrieval system