KEGG   Bacillus subtilis subsp. subtilis 168: BSU17130
Entry
BSU17130          CDS       T00010                                 

Gene name
acpK
Definition
(RefSeq) polyketide biosynthesis acyl-carrier-protein AcpK
  KO
K15337  polyketide biosynthesis acyl carrier protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17130 (acpK)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  beta-Branched incorporating proteins
   BSU17130 (acpK)
SSDB
Motif
Pfam: PP-binding
Other DBs
NCBI-GeneID: 937952
NCBI-ProteinID: NP_570904
Pasteur: BG14186
BSORF: BG14186
UniProt: Q7PC63
Position
1788469..1788717
AA seq 82 aa
MDKQRIFEVLITNICEVLPELDGHRFEPEDQLVELGADSVDRAEIITMVLEDLSLKIPRI
ELSGVKNIGELAEVLYDKVQSA
NT seq 249 nt   +upstreamnt  +downstreamnt
atggataaacagagaatctttgaagtattaatcaccaatatttgcgaggtgcttcctgaa
ttagacggacacagatttgagcctgaagatcagttagttgagctaggagctgactctgta
gacagagctgaaattatcacgatggtgctagaggatttatcgttaaaaatccctcgcatt
gagctatccggggtgaaaaacatcggtgaattagctgaggtgctttatgacaaagtgcaa
tctgcctga

DBGET integrated database retrieval system