KEGG   Bacillus subtilis subsp. subtilis 168: BSU17140
Entry
BSU17140          CDS       T00010                                 

Gene name
pksF
Definition
(RefSeq) polyketide biosynthesis malonyl-ACP decarboxylase PksF
  KO
K00646  malonyl-ACP decarboxylase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17140 (pksF)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  beta-Branched incorporating proteins
   BSU17140 (pksF)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Other DBs
NCBI-GeneID: 939500
NCBI-ProteinID: NP_389594
Pasteur: BG10925
BSORF: BG10925
UniProt: P40804
Position
1788695..1789942
AA seq 415 aa
MTKCNLPEVVVTGVGVTASIGQGKEDFASSLLSGRHAFDVMKRSGRQKDSRFIGAEIASL
SYPDRLSKKMLRKASFSSRAALVTLTEAWEEAELDDADSSRIGLVVGGSNFQQRENFEVY
ERYQDRSGFISPAYGLSFMDSDLCGICTDQFGITGLAYTVGGASASGQLAVIHAIQQVLS
GEVDTCIALGALMDLSYMECEALRALGAMGTDKYADEPENACRPFDQNRDGFIYGESCGA
LVIERKETALRRGLKPYAALSGWSIKLDGNRNPDPSLEGEIHVIQKALERARLLPEDIDY
INPHGTGSFIGDEIELKALRACRLSHAYINATKSITGHGLSAAGIVEIISVLLQMKKSAL
HPSRNLDHPIDDSFHWVNEKSISYRIKNALSLSMGFGGMNTAVCIQNIEKCGGES
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgacaaagtgcaatctgcctgaggtggtggtgaccggtgtaggcgttacggcctctatc
ggtcaagggaaagaggactttgcttcctcgctgctgtccggcagacatgcctttgatgtc
atgaagcgttcaggcagacaaaaagacagccggtttatcggagccgaaattgcgtcattg
tcttatcctgaccgactctctaaaaaaatgttgcgaaaagcatcattctccagccgcgct
gcattggtaactctcacagaggcttgggaggaggctgaattggacgatgcagattcctca
cgtatcggactggttgttggcggatcaaattttcaacagagagaaaactttgaagtttat
gaaaggtatcaagaccgctccggttttatttctccggcgtatggtctgtctttcatggac
agcgatctttgcgggatatgtacagatcagtttggcatcacgggattagcatatacggtg
ggaggagcttcggccagcggccagttagcagtcattcatgcgattcagcaagtcctgtca
ggcgaagttgatacttgcatagcacttggtgctttaatggatctttcttatatggaatgc
gaggcgctaagggctttaggcgctatggggacggacaaatatgctgatgaacctgaaaat
gcgtgccgtcccttcgatcaaaacagagacgggtttatctatggagaatcgtgcggtgca
ttggtaatagaacgaaaggagacggctttacgaagaggtctaaaaccttatgcagcattg
tctggctggtcaatcaaactggacggaaaccggaatcctgatccttcattagaaggagag
attcatgtcatccagaaggcactggagcgtgccaggcttttaccagaagatattgattat
attaatcctcatggaacaggctcttttattggagatgaaatagaattaaaggcgctccgt
gcatgccggctttcccatgcttatatcaatgcaacaaaatcgataaccggacacgggctt
agtgcggcgggcatcgtagagattatttctgttttgctgcaaatgaaaaaatctgccctg
catccgagcaggaatttggatcatccaatcgatgattcctttcattgggtaaatgagaaa
tcgatttcataccgcatcaaaaatgcgctgagcttaagcatggggtttggcggaatgaac
accgcggtttgtatacaaaacattgagaaatgtggaggcgaatcataa

DBGET integrated database retrieval system