KEGG   Bacillus subtilis subsp. subtilis 168: BSU17150
Entry
BSU17150          CDS       T00010                                 

Gene name
pksG
Definition
(RefSeq) polyketide biosynthesis 3-hydroxy-3-methylglutaryl-ACP synthase PksG
  KO
K15311  polyketide biosynthesis 3-hydroxy-3-methylglutaryl-CoA synthase-like enzyme PksG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17150 (pksG)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  beta-Branched incorporating proteins
   BSU17150 (pksG)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N Chal_sti_synt_N ACP_syn_III ACP_syn_III_C
Other DBs
NCBI-GeneID: 940121
NCBI-ProteinID: NP_389595
Pasteur: BG10926
BSORF: BG10926
UniProt: P40830
Structure
PDB: 
4YXT 4YXQ 4YXV

Position
1789943..1791205
AA seq 420 aa
MVSAGIEAMNVFGGTAYLDVMELAKYRHLDTARFENLLMKEKAVALPYEDPVTFGVNAAK
PIIDALSEAEKDRIELLITCSESGIDFGKSLSTYIHEYLGLNRNCRLFEVKQACYSGTAG
FQMAVNFILSQTSPGAKALVIASDISRFLIAEGGDALSEDWSYAEPSAGAGAVAVLVGEN
PEVFQIDPGANGYYGYEVMDTCRPIPDSEAGDSDLSLMSYLDCCEQTFLEYQKRVPGANY
QDTFQYLAYHTPFGGMVKGAHRTMMRKVAKVKTSGIETDFLTRVKPGLNYCQRVGNIMGA
ALFLALASTIDQGRFDTPKRIGCFSYGSGCCSEFYSGITTPQGQERQRTFGIEKHLDRRY
QLSMEEYELLFKGSGMVRFGTRNVKLDFEMIPGIMQSTQEKPRLFLEEISEFHRKYRWIS
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggtttcagccggaatagaagcgatgaatgtctttggcggaacggcataccttgatgtc
atggagctggccaaatacagacacttagatactgcgagatttgaaaatttattaatgaaa
gaaaaagcggtagcactgccttatgaagatcccgtgaccttcggagtcaatgcagctaag
ccgattattgatgctttatctgaagcagagaaggaccggattgaattgctgatcacttgc
tctgaatccgggatcgactttgggaaatcgttaagtacatatatccatgaatatttaggt
ctcaaccgcaactgccgtttgtttgaggttaaacaggcgtgttattcagggacagcggga
tttcagatggcggtgaattttatattatcccagacttctccgggtgccaaagcactggtt
atcgccagtgatatttcacgttttttaatcgctgagggcggagacgctttaagcgaagat
tggtcttatgcggaaccgagcgccggagcgggagcggtggccgttttagttggcgaaaat
cccgaggtgtttcaaatagatcccggagcaaatggttattacggctatgaagtgatggac
acgtgccgccccattcccgacagtgaagcgggagattctgatctgtctttaatgtcatat
ttggattgctgcgaacagacttttctggaatatcaaaagcgtgtaccgggtgccaattat
caggacacgtttcaatatcttgcttaccatacgccctttggcgggatggtgaaaggtgcg
caccggacaatgatgcgtaaggtagcgaaggtgaaaacatccgggattgagacggatttt
ttaactcgggtaaaaccaggtttaaactactgtcaacgggttggaaatattatgggggca
gccttgtttctggcattggccagcacgatagaccaagggagatttgatacgcctaaacga
attggctgtttttcctacggatccggctgctgttctgaattttacagcggaattacaact
ccgcaaggccaggagcgtcagcgaacatttggtattgagaagcatttggatcgccggtat
cagctctccatggaagagtatgagctattgtttaaggggagcgggatggtgcggtttggg
acgcgcaatgtaaagctggactttgagatgataccgggcatcatgcagtccactcaagag
aagccgcgcttgtttttagaagaaatttctgagtttcatcggaagtacaggtggatctcg
tga

DBGET integrated database retrieval system