KEGG   Bacillus subtilis subsp. subtilis 168: BSU17160
Entry
BSU17160          CDS       T00010                                 

Gene name
pksH
Definition
(RefSeq) polyketide biosynthesis enoyl-CoA hydratase PksH
  KO
K15312  polyketide biosynthesis enoyl-CoA hydratase PksH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17160 (pksH)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  beta-Branched incorporating proteins
   BSU17160 (pksH)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 940033
NCBI-ProteinID: NP_389596
Pasteur: BG10927
BSORF: BG10927
UniProt: P40805
Structure
PDB: 
3HP0

Position
1791193..1791972
AA seq 259 aa
MDLVTYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLP
EVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVS
ATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGL
IDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQ
NQMGIIRYVETGQFPWEDQ
NT seq 780 nt   +upstreamnt  +downstreamnt
gtggatctcgtgacctatcaaacgataaaggtccgctttcaagcatcggtttgctatatt
acctttcaccgtcctgaagcgaataatacgattaatgacacgctgatagaagaatgcttg
caagtgttaaaccaatgtgaaacatcaacggtgacggttgtcgttttagaggggcttccc
gaggtgttttgtttcggagcggattttcaagaaatctatcaggaaatgaaaaggggcaga
aaacaggcaagctcccaagagcctctctatgatttgtggatgaaattgcagaccggccct
tatgtcacgatttcgcatgtcaggggaaaagtgaatgccggcggtcttggatttgtatct
gccacagatattgccattgctgatcagacggcgtcattcagtctctctgagctgctattc
ggcctgtaccctgcttgtgttttaccgtttctgatccgccgtatcggccggcagaaagcg
cattatatgacgcttatgacaaagccgatttccgttcaggaagccagtgaatgggggtta
atagatgcttttgatgctgaaagtgacgtgctgctgagaaagcatttattgcgtttgcgg
aggctgaataaaaaaggaatcgcacattataaacagtttatgagctcacttgatcatcaa
gtcagtcgtgcgaaagccaccgctttaactgcaaatcaagacatgttttctgatcctcaa
aaccaaatgggaatcatcaggtatgttgaaacaggacaattcccatgggaggatcagtaa

DBGET integrated database retrieval system