KEGG   Bacillus subtilis subsp. subtilis 168: BSU17170
Entry
BSU17170          CDS       T00010                                 

Gene name
pksI
Definition
(RefSeq) polyketide biosynthesis enoyl-CoA isomerase PksI
  KO
K15313  polyketide biosynthesis enoyl-CoA hydratase PksI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17170 (pksI)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  beta-Branched incorporating proteins
   BSU17170 (pksI)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 940096
NCBI-ProteinID: NP_389597
Pasteur: BG10928
BSORF: BG10928
UniProt: P40802
Structure
PDB: 
4Q1K 4Q1H 4Q1G 4Q1I 4Q1J

Position
1792012..1792761
AA seq 249 aa
MTHSVVELIEIESAIIQVKMQDRTHKNAFSQELTDDLIQAFEYIRQNPKYKAVILTGYDN
YFASGGTQEGLLRIQQGLTKFTDDNLYSLALDCEIPVIAAMQGHGIGGGFVMGLFADIVI
LSRESVYTANFMKYGFTPGMGATFIVPKKLGFSLAQEILLNAGSYRGADLEKRGVPFKVL
PRAEVLDYAVELAQELAEKPRNSLVTLKDHLVAPLRDQLPRVIEQELMMHEKTFHHEEVK
SRIKGLYGN
NT seq 750 nt   +upstreamnt  +downstreamnt
atgacgcattctgttgtagagcttatcgaaattgaatccgccattattcaggtaaagatg
caagatcgcactcataaaaacgcgttttcacaagaacttacagacgatttaattcaagcg
tttgaatacatacggcagaatcccaaatacaaagcggtcattttgacaggatatgataat
tattttgcttcaggaggaacgcaagaaggactgcttcgaattcaacagggattgaccaag
ttcactgatgacaatctttattctctggcgctggattgcgagattccagttattgcggca
atgcagggccatggaattggaggcggctttgtcatggggctctttgctgacattgtcatt
ctgagcagagaaagcgtgtatacggctaattttatgaaatacggatttacgcctggaatg
ggcgctacctttatcgttcctaaaaaactgggtttcagcctggcccaggaaatattattg
aatgcgggcagctaccgcggagctgatcttgaaaaaagaggggttccttttaaggtgctg
ccccgtgcagaagtgttagattatgcagtggagctggcgcaagaactggcggaaaagccg
agaaactcactggttacactgaaagatcatttggttgccccgcttcgcgatcagctgccg
cgcgtcattgaacaggaattgatgatgcatgagaaaacatttcatcatgaagaagtcaaa
agtagaatcaaaggtttatatggtaattaa

DBGET integrated database retrieval system