KEGG   Bacillus subtilis subsp. subtilis 168: BSU17190
Entry
BSU17190          CDS       T00010                                 

Gene name
pksL
Definition
(RefSeq) polyketide synthase PksL
  KO
K13612  polyketide synthase PksL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU17190 (pksL)
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17190 (pksL)
Lipid biosynthesis proteins [BR:bsu01004]
 Polyketide synthase
  Modular PKS
   BSU17190 (pksL)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   trans-AT PKS
    Bacillaene PksX synthase
     BSU17190 (pksL)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KR PS-DH PP-binding KAsynt_C_assoc Thiolase_N adh_short adh_short_C2 ACP_syn_III GDP_Man_Dehyd Thiolase_C
Other DBs
NCBI-GeneID: 940032
NCBI-ProteinID: NP_389600
Pasteur: BG10698
BSORF: BG10698
UniProt: Q05470
Structure
PDB: 
5E1V 5E5N 5E6K 5ERF 5ENY

Position
1807921..1821537
AA seq 4538 aa
MRWRSNVKKITKQLTLSLKNPFIYHHVVYGQNVLPGLAYIDIIYQIFREHGFSCSELQLR
NLSIYQPLTAEQDAVIVLNIQCAEKKEGQWQITAKGIEKRDGKEASEEKLYMKADMHADS
PAIFEETLDLSQIKASAQNVVQLDDVYEQCRRQELVHSEYMKAKGCIYEEEDGVLLELSL
GSEAMLHAEGFMFHPTLIDGSGVGANHLLTSLLKGEQRLYLPLFYESFSASALLQTDCMT
RIKRSSVRREKELIYVTLEFFNASGEKVAELKNFTSKLVREAELISGKHQDAQETQMTRA
DTAERDKPADMVSSPVNSYSEAEQFVSQLIAEKINKPVEQVEKQVGYYQMGLNSSGLLEV
VETISDKIGESLSPTLLFEHTTIAELSAFLAEEYAEHFSAAGSLGQNERARVSDSINDHK
TVEGSRPAPIEAAGDIAIIGLAGRYPKAANIHEFWNNLKEGKDCVSEIPESRWDWQRLEG
ITSPSGKDISKWGGFIDDPDCFDPQFFRITPREAETMDPQERLFLETCWETIEDAGYTPK
TLAKPKGRNKRQHVGVFAGVMHKDYTLVGAEEASAENVFPLSLNYAQIANRVSYFCNFHG
PSMAVDTVCSSSLTAVHLALESIRHGECDVALAGGVNLSLHPNKYMTYGVWDMFSTDGHC
RTFGKDGDGYVPAEGIGAVLLKPLRQAEEDGDRIYAVIKGSAVNHVGTVSGISVPSPVSQ
ADLIETCLEKTGIDPRTISYVEAHGTGTSLGDPIEIQGLVKAFRQYTQDRQFCSIGSVKS
NIGHAESAAGISGLSKVALQLHHQKLVPSLHSEELNPYVDFEKSPFYVQHETETWKQPVI
KENGEDVPYPRRAGISSFGATGSNAHIILEEHIPQAAEQDVSLSSDSDISAVIPLSARNQ
ERLRVYAKRLLDFLHDGIQIRDLAYTLQVGREPMEERVSFLASGIQELSDQLKAFIEGRK
AIQHCWKGRVSRGSEPSRPAESVHKLLEQRKLDQIAEQWANGSGVDWKLLYEGSKPKRIS
LPTYPFERVRYWVPKAEKKTDRSKQERHILHPLLHQNVSDISGVRFRSAFTGREFFLKDH
VIKGEHVLPGAALLEMVRAAVERAAADQFPTGFRLRNIVWVRPFAVTEQQKDIDVRLYPE
ENGEITFEICRDPESAEESPIVYGQGSAVLCEAGENPVINIEELKASYNGRTLSPFDCYE
AYTEMGIHYGDSHRAIDSLYAGENGVLVKLTMPPVISDTEDHYILHPSMIDSAFQASIGL
RLGGATSLEDRKAMLPFAIQDVRIFKGCEASMWARITYSEGSTAGDRMQKLDIDLCNEEG
QVCVRLTSYSARVLETDQEGPSEANDTLLFEHIWEERAAERQELIEYDTYKVVVCDVGEQ
MESLQNHLDCTVLQHDTETIDERFEGYAIQLFEEIKQLMHSKTGGHTFIQVAVPALDEPQ
LLSGLTGLLKTAELENPKLTGQLIEIETGMSAGELFEILEENRRYPRDTHIRHWQGKRFV
SKWKEVSGEHLSADMPWKDKGVYLITGGAGGLGFIFATEIANQTNDAVVILTGRSPLDER
KKKKLKALQKLGIQAIYRQADLADKQTVDALLKETQNVYGDLDGIIHSAGLIKDNFIMKK
KKEEVQTVLAPKVAGLIHLDEATKDIPLDFFILFSSGAGAVGSAGQADYAMANAFMNAFS
EYRNGQAELHKRYGKTLSVCWPLWKDGGMQIDAETARMLKRETGMVAMETDRGIQALYHG
WTSGKPQVLVASGVTDRIRAFLHETGHGKGQSHNIKKSSLNQEAEKADMIGEIDEEILRE
KAENYFKQVLSSVIKLPAGQIDAEAPLEDYGIDSIMIMHVTGQLEKVFGSLSKTLFFEYQ
DIRSLTRYFIDSRREKLLDILGFETGKPSVERKSEPEKQEIPVIPRKSGFLPLQDKEQKQ
VREKETEEIAIIGISGRYPQADNIDELWEKLRDGRDCITEIPADRWDHSLYYDEDKDKPG
KTYSKWGGFMKDVDKFDPQFFHISPREAKLMDPQERLFLQCVYETMEDAGYTREHLGRKR
DAELGGSVGVYVGVMYEEYQLYGAQEQVRGRSLALTGNPSSIANRVSYYFDFHGPSIALD
TMCSSSLTAIHLACQSLQRGECEAAFAGGVNVSIHPNKYLMLGQNKFMSSKGRCESFGQG
GDGYVPGEGVGAVLLKPLSKAVEDGDHIYGIIKGTAINHGGKTNGYSVPNPNAQADVIKK
AFVEAKVDPRTVSYIEAHGTGTSLGDPIEITGLSKVFTQETDDKQFCAIGSAKSNIGHCE
SAAGIAGVTKVLLQMKYRQLAPSLHSNVLNPNIDFLNSPFKVQQELEEWKRPIISVNGKD
IELPRIAGVSSFGAGGVNAHILIEEYAPEPVEERLPARKQPAVIVLSAKNEERLQKRAER
LLHAIREQTYVEADLHRIAYTLQVGREAMKERLAFVAETMQELEEKLYECISGTENREYV
YRGQVKSNKEAIAAFAADEDMSKTIEAWLQKGKYAKVLDLWVRGLRIDWSTLYQDQKPRR
ISLPAYPFARDRYWIDVNAKAEEKRTEEPFAPVQPVIPKPSVDREASGKPANITLQPLMT
NQDRLERVPSDTETETITAEALCDELTAGLAEVLYMDQNEIDPDEAFIDIGMDSITGLEW
IKAINKQYGTSLNVTKVYDYPTTRDFAVYLAHELSTQAGEKKQTETYTPIRQKTVVPAAK
PANISLQPLEHHQPVQEEAEETIQYAAAEISASRQYTVAIETLHENLRESIADVLYMEPY
EVDIDEAFIDIGMDSITGLEWIKAVNKQYGTSFTVTRVYDYPTIRDFAEMLKSELGTHLD
RKIEHTDSFEAAQQKPAASSHPKPAERPLQPVQHPIKKEHEKKTVPVLQDRPEDAIAIVG
MSGRYPGARNVREYWDNLVHARNAIRDIPTSRWDVDKYYDPVLNKKGKVYCKSMGMLDDI
EHFDPLFFNIPPSEAELMDPQHRIFLQEGYKAFEDAGYNARTLNEKKCGVYLGIMSNEYG
VMLNRQSRANATGNSFAIAAARIPYFLNLKGPAIPIDTACSSSLVGTHLARQALINKEID
MALVGGVSLYLTPESYMSMCEAGMLSPDGQCKAFDNGANGFVPGEGAGALVLKRLKDAEA
DRDHIYGIIIGSGINQDGKTNGITAPSAKSQMDLERDIYETYGIHPESISYVEMHGTGTK
QGDPIELEALSTVFQEKTDKKQFCAIGSVKSNIGHTSAAAGVAGVQKVLLCMNHKTLVPT
LNFTTPNEHFEFEHSPLYVNTELKPWETADGKPRRACVSSFGYSGTNAHIVIEEYQPEKR
NDRLTKQHRSALFVLSAKKEKQLKAYAEAMKDFVTSNEDIDLEDMAYTLQTGREAMDYRM
AFLADSREMLIKALDDYLAEMPNGSIFAAHVKTKKSEIKLFETDHDAKALLQTWIEKKRL
EKVAELWVKGLQIDWNKLYGEYTPRRISLPAYPFAEEYYWLPTQEGEPETIATAMPQFEL
MPKRCFLRKQWQPCPIEPAEMTNQTVAILANEETMALAEELSAYFSTYRIFDSQELDRVS
AADYEHVAGAIDLIGCGTSHEHSMGWINWLQKLIEQGRASKHHLTVLGVTKGLEAYANEG
VLLSGASRAGLYRMLQSEYSHLTSRHADMECEASHEELARLIAVEYYAKSTESEVCYRNG
QRYRAYLTEQPAEAALSHKQVSFSTDKVLLITGGTRGLGLLCARHFVKTYGVKRLVLIGR
EELPPRDQWNSVKISSLAEKIKAVQELEDMGAQVQVLSLDLTDRVAVEQSLKTIHETMGA
IGGVIHCAGMVNKQNPAFIRKSLEEIGQVLEPKVEGLQTLFDLLQDEPLAFFTLFSSVSA
AIPALAAGQADYAMANAFMDYFAEAHQDKCPIVSIQWPNWKETGLGEVRSKALEQTGLIS
LTNDEGLQLLDQILSDRQYAVVLPAVPDTNVWKPDKLMQPSLPVEALSHPETKEQTSTRN
LFPETVDWLVTLFSDELKIAAEDFETDEPFQEYGIDSIILAQLVQQMNQQLNGDIDPSIL
FEYPTIESFAHWLISKYDISAVLQPSVPEKQTPLKPQSAMKQKLVPEQRPQQISHEKTAL
LAEDIAIIGLSCRFPGAETLEEYWDLIRDGRSAIAPVPPERFGNSSSNYAGLIDEMNRFD
HDFFMMSESDVRAMDPQALAVLEESLKLWYHAGYTEKEVKGMRAGVYIGGRSQHKPDPAS
LSKAKNPIVAGGQNYLAANISQFFDLKGPSIVLDTACSSALVGLNMAIQALRSGDIEAAV
VGGVSLLDADAHRMFHERGLLCDKPSFHIFDKRADGVILGEGVGMVLVKTVNQAVEDGDS
IYAVIKAAAINNDGRTAGPSSPNLEAQKDVMLSALEKSGKKTEEISYLEANGSGSAVTDL
LELKAIQSIYRSESKAPLGLGSVKPNIGHPLCAEGIASLIKVALMLKHRQLVPFLSGNEN
MPYFDIEKTDLYFSRSQAEWKETTPAAAINCFADGGTNAHLIIEGWRDSAERPIRRKPLP
LPELNRQPVLIKPSAQNVQKKVHSDTGASKDMFWKTFK
NT seq 13617 nt   +upstreamnt  +downstreamnt
atgaggtggaggtctaacgtgaaaaagataacgaaacaactcacattatcgttaaaaaat
ccgtttatttatcaccatgtggtttacggacaaaatgtcctgccgggattggcttatatc
gatataatctaccagatattcagagaacacggtttctcctgctcagagcttcagctgcgg
aatttatccatctatcagccattgacggcggaacaggatgcagtaattgttttgaatatc
caatgcgcggagaaaaaagaaggacagtggcaaatcacagccaagggaattgaaaaacgt
gatgggaaagaagcttcagaagaaaagctctatatgaaggctgacatgcacgcagactcc
ccagccatatttgaagaaacactggatctcagtcaaatcaaagcatctgcacagaacgtt
gttcagcttgatgatgtatatgaacaatgcagacgtcaggaattggtgcacagcgaatat
atgaaagcaaaaggctgcatctatgaagaggaagacggcgtccttcttgagctttctctc
ggttcggaggccatgcttcacgcagaaggctttatgtttcacccgactctcatagacggg
agcggggtgggtgccaatcatttgctcacatctttgcttaaaggagaacagaggctgtat
ttgcctctgttctatgaatccttttccgcttctgcacttttgcaaacggattgcatgaca
agaattaagcgctcctccgtccggcgggaaaaagagctgatttatgtaacacttgaattt
tttaatgcgtcgggagaaaaagtggctgagttgaaaaactttacaagcaaattggtgcga
gaagcggagctgattagcggaaaacatcaagatgcacaggagacacagatgacaagagcg
gacactgctgagcgtgataaacctgctgacatggtatcttctcccgttaattcctatagt
gaggctgaacagttcgtaagccaattaatcgcagagaaaatcaataagccggtagaacaa
gttgaaaaacaggtcggttattaccaaatgggactgaattcatcgggcttgcttgaggtg
gtagaaacgatcagtgataagatcggtgagagcctttcgccgactcttctgtttgagcat
accaccatagcggaactgtcagcgtttcttgccgaggaatatgctgagcattttagtgcc
gctggttctcttggccagaatgaaagagcacgcgtttccgacagcataaacgaccataag
actgttgaaggctctcgtcctgcacctattgaggcagcaggcgatattgcgattatcggc
ttggcgggcaggtatccgaaggcagccaatattcatgaattttggaacaatctgaaagag
ggtaaggactgcgttagtgagattcctgagtcgcgctgggattggcagcgacttgaagga
atcacatctccttcgggtaaggacatttccaaatggggaggatttattgatgatcccgac
tgcttcgatccccaatttttcagaatcacgccaagagaagcggagacaatggaccctcaa
gagcggctgtttttagaaacatgctgggaaacgattgaagatgcgggctatacgccaaag
acgttggccaagcctaaaggacgaaataaaaggcagcatgtaggagtttttgcaggcgtc
atgcacaaggattatacattagtcggagctgaagaagcatcagcagaaaatgtgtttcct
ctttcgctcaactatgcgcaaatcgccaaccgtgtttcttacttttgtaatttccacggt
ccgagtatggctgtcgatacggtatgttcatcctctttgaccgcagtgcacttggcgttg
gaaagcatacgtcacggtgagtgcgatgttgcgttagcaggcggagtgaacctgtctttg
cacccgaataaatatatgacatacggggtctgggatatgttttccactgacggacactgc
cgtacgtttggaaaggatggagacggttatgtgcctgcagagggtataggcgcggtttta
ttaaagcctttgcgccaggcagaggaagacggagatcgcatttatgcagttattaaagga
agtgctgtgaatcatgtgggcactgtaagcggcatttcagtgccgagccctgtttcccaa
gctgatctgattgagacatgcttggagaaaacgggaatcgatccgcggacgatcagttat
gtggaagcccatggaaccggcacgtccttaggagatccgatcgaaatacagggattagtg
aaagcgttccgccaatatacgcaggatcggcagttctgttcaatcggttctgtaaagtca
aacattgggcacgccgaatccgccgcggggatcagcggtttaagcaaggttgctcttcag
cttcaccatcaaaaacttgtgccttctttgcattcggaagaactgaatccgtacgttgat
tttgaaaagtctccattttatgtacagcatgaaacagaaacgtggaagcagcctgttatc
aaggagaatggggaagacgtcccttatccgcgacgggcggggatcagttcttttggcgca
acaggttcaaacgcacatattatccttgaggaacatattcctcaagcagcggagcaggac
gtttctttgtcctcagattctgacatatccgcagttattccgctttctgcccgtaatcaa
gaacgtctccgtgtatatgcaaaacgtctcttggattttcttcatgatgggattcagatt
agagatttggcgtatacattgcaggtaggccgtgaaccgatggaagaacgggtttctttc
ttagcatccggaattcaagaattgagcgaccaattgaaggcttttatagaaggacgaaaa
gccattcagcattgctggaagggccgcgtgtcaagaggaagcgaaccatcgcgtcccgcc
gaatcggtacataaattgctggagcaaagaaaactcgatcagattgcggagcagtgggcg
aacggatctggtgttgactggaagctgctttacgagggaagcaaaccaaagcggatcagc
ctgccgacttacccatttgagagggtgcgttattgggtgccgaaagcggagaaaaagact
gatcgttcaaaacaggagcggcacatcctgcatcctcttctgcatcaaaatgtgtccgac
atatcgggtgtccgcttccgttcagcgtttacaggacgtgaatttttcttgaaggatcat
gtcataaagggcgaacacgttttacctggcgcagctttattggagatggttcgggcagct
gtggaaagggcagctgcggatcagttcccgacaggattccggctccggaatatcgtctgg
gtccggccgttcgccgtcacggaacagcagaaagatatagatgtacgtctatatcctgag
gaaaatggtgagattacatttgaaatctgccgggaccctgaaagcgcagaggagtcgccg
attgtatatgggcaagggagtgcagtgctttgtgaggctggtgaaaatccggttatcaac
attgaagaattgaaggcaagctataatggccggacgctgtcaccttttgattgctacgag
gcttatacagaaatgggtattcattatggtgacagccacagagcgatcgacagcctatat
gccggcgaaaacggagttctagtgaaattgacgatgcctcctgtaatctctgatacagaa
gaccattatattctgcatccgagcatgatagattcggcatttcaagcatctatcggtttg
aggctgggaggagctacgagtttagaagacagaaaggcaatgctgccttttgccatacag
gatgtccgaatcttcaaaggctgcgaggcatctatgtgggcgcggatcacatatagcgag
ggcagtacagctggggatcgtatgcagaagcttgatatcgatttatgcaatgaagagggc
caggtttgcgtgcgattgacgagctattctgcaagagtgttagaaacagatcaagaaggt
ccttctgaagcgaatgacacgctattgttcgaacatatttgggaagaacgtgctgcagag
aggcaagagctcatagagtacgacacgtataaagtcgttgtctgtgatgttggagaacaa
atggaaagcctccaaaatcatcttgactgtacagttctgcagcatgatacagagacaatt
gatgaacggtttgaaggttatgccatacagttatttgaagaaatcaaacagctaatgcac
tcaaaaacaggaggacatacattcattcaagtggcggtgcctgcgttggacgagcctcag
ctattaagcggcttaactggattgctcaaaacggctgaactggaaaatccaaaactgaca
ggacagttgatcgaaatagaaaccgggatgtcagctggtgagctattcgaaatattggag
gaaaacagacgctatccgcgtgacacgcatatccgccactggcaagggaagcgatttgta
agcaagtggaaagaagtgtctggtgagcacctaagtgctgacatgccatggaaggataaa
ggcgtgtatctgatcacaggcggtgcgggcggtctgggattcatctttgcaactgaaatc
gcaaaccaaacgaatgatgcggttgtgatcctgacaggacgctctccgcttgatgaaagg
aagaagaagaagcttaaagccttacagaaacttggcatccaagcgatttacagacaagct
gatctggctgacaaacaaacggttgatgccttattaaaagaaacccaaaacgtttacgga
gacttagatggcatcattcatagcgccggtttaataaaagataatttcattatgaagaaa
aagaaagaagaggttcaaaccgttcttgctccaaaggtagcaggactgattcaccttgac
gaagcaacgaaagatattccgctcgatttctttatccttttttcctcaggtgccggagca
gtaggaagcgcgggacaggctgattacgcaatggccaatgcatttatgaatgcattcagc
gaatatcgaaatggccaagcagagctgcataagcgttacggaaaaactctttcagtgtgc
tggccgctgtggaaagacgggggcatgcaaattgatgcggaaactgcaaggatgctgaaa
agagaaacaggcatggtggccatggaaacagatcgtgggattcaggcgctatatcatggc
tggacgtcaggaaagccgcaagtgttagttgcttccggtgttactgatcggattcgtgca
tttttacatgaaacgggacatggcaaaggccaatctcacaatatcaaaaaaagcagtctc
aatcaggaggcagaaaaagcagacatgatcggggaaattgatgaagagatactaagagaa
aaagcggagaactattttaaacaggtgctttcttcggtgattaagctgccagctggccag
attgatgctgaagctcctctcgaggattacgggatcgattctatcatgatcatgcatgta
acgggtcaattagaaaaagtattcggatctttgtccaagacgctgttctttgaataccag
gatattcggtcattaacccggtattttattgattcccgcagagaaaaactgctggacatc
ttgggatttgaaacgggaaaaccttctgttgaaagaaaatcagaacctgaaaaacaagaa
atcccagttatcccaagaaagtctggatttcttcctttgcaagataaagagcagaagcag
gtaagagagaaggaaacggaagaaattgcgatcatcggtatctcaggtcgctatccgcag
gcagacaacattgatgaattatgggaaaaactgagggacgggcgagactgtattacggaa
attcctgcagaccgctgggatcacagtctttattatgacgaagataaagacaagcctgga
aaaacctacagcaagtggggcggcttcatgaaggatgtagacaagtttgacccgcagttt
ttccatatttcgccgcgtgaggcaaaattaatggacccgcaagagcgtttatttttgcag
tgcgtgtatgaaacgatggaagacgcaggctatacaagagagcacctcggccgtaagcgt
gatgctgagcttggcggaagcgtcggtgtttacgtcggtgtcatgtacgaagaatatcag
ctgtacggggcacaagagcaggtgcggggaaggtctctggctttaacgggaaatccatca
tccatcgcgaaccgggtatcttattattttgattttcacggaccgagtattgctttagac
accatgtgttcttcttctttaacggctatccacttggcctgccaaagcctgcagcgcgga
gaatgtgaggcggcattcgcgggcggcgtgaatgtgtcaatccatccaaataaatatttg
atgctcgggcagaacaaatttatgtccagcaaaggccgatgtgaaagcttcggacagggc
ggagacggctatgtgccgggggaaggcgttggagcagtgcttttgaagccattgtctaaa
gcagttgaagatggtgatcacatttatggaatcattaaggggacagccatcaaccacggg
ggaaaaacaaacgggtactcagtgcccaatccgaatgcccaagcagatgtcatcaaaaag
gcgtttgtggaagcgaaggttgatccgcggacagtcagttacatcgaagcccacggcacg
ggaacctctctcggtgatcctattgaaatcacagggctgtccaaagtgtttacgcaagaa
accgatgacaaacaattttgtgcaatagggtcagccaaatcaaatatcgggcactgtgag
agtgcggcaggtattgcaggagtaacgaaggtattgctccaaatgaaatacaggcagctt
gcgccttccctgcattcaaacgtgctgaacccgaatattgatttccttaactcgccgttt
aaagtacagcaagagctagaagagtggaagaggccgatcatcagtgtcaatggcaaagac
atcgaattaccgagaatcgcaggagtctcttcatttggtgccgggggtgtgaacgcccat
attttaatagaagagtatgctccggaacctgtggaggaacgtttaccagcgaggaaacag
ccggctgtcattgtgctctcagcaaaaaatgaggaaagacttcagaaacgcgcggagcga
ttgctgcatgccattcgtgaacaaacatatgttgaagcagatttacaccgaattgcctat
acgctgcaagtcggccgggaagcgatgaaagaacggctggcgttcgttgcggaaacgatg
caagagcttgaagaaaagctgtatgaatgtatctccggaacagaaaatcgtgaatatgtc
tatcgcggacaagtaaagagcaacaaagaagccattgctgcttttgctgctgatgaggat
atgtcaaaaacaattgaggcatggctgcaaaaaggaaaatatgcgaaggttttagacctg
tgggtaagaggtttgcgaatcgactggagcacgctatatcaggatcaaaaaccgcggcgc
atcagtttacctgcctatcctttcgcaagagatcgctattggatagacgtaaatgcaaag
gctgaggaaaaaagaacggaggagccattcgctccagtacagcccgttattccgaagccg
tctgtagacagagaagccagtggcaagcctgccaatattacgttacagcctttaatgacc
aatcaggatcgtttagagcgtgttccatcagatacagaaacagagacgatcacggcggaa
gccttgtgcgatgaactgacagcgggcttagcggaagtgctgtacatggaccaaaacgag
attgatccagacgaagcattcatagatatcggtatggactcgattaccgggctcgaatgg
ataaaagcaataaataaacagtatggcacatcactaaatgtcacaaaggtatatgattat
ccgacaacacgtgatttcgctgtttacttagcacacgagttaagcacacaagctggggag
aaaaaacaaacggagacgtacacgccgatcagacaaaaaacagtggtacctgctgctaaa
ccggctaatatatctctgcagccgttagaacatcatcagccagtgcaagaggaagctgaa
gaaacgattcaatatgcagcggcagaaatatctgcatcaagacaatatactgtagcaatt
gaaacgctgcatgaaaacttgagggaaagcatagcagacgtgttatacatggagccatac
gaggtggatattgacgaagcgttcatagatatcggaatggactcgattaccggactcgaa
tggataaaagcggtgaacaagcaatacggaacgtcttttacggtaaccagagtatatgat
tatccaacgatacgtgattttgccgaaatgctaaagtccgagcttggaactcatcttgat
agaaagatagagcatactgactctttcgaagcagcccagcaaaagccagcagcatcatct
catccaaagccggcagaacggccactacagcctgttcaacatccaataaagaaagaacat
gagaagaaaacggttcctgttcttcaagaccgcccggaggatgcgatagcgattgtcggg
atgtcgggaagatacccgggcgctcgtaatgtaagagagtactgggataacctggttcat
gcgagaaatgccattcgggacattccaacatcacggtgggatgttgacaaatactatgat
cctgtcctcaacaaaaaagggaaagtctattgcaaatcaatggggatgcttgatgatatt
gaacattttgatccgttgttttttaatattccgccgtcagaagctgaactgatggacccg
cagcatcgaatctttttgcaggaaggctataaagcctttgaggacgctgggtacaacgcc
cgaactttaaatgagaaaaaatgcggtgtatatctcggcattatgagcaatgaatacggg
gtcatgctgaatcggcagtcaagagcaaatgccaccggaaacagctttgcgatcgcagcg
gcgcgtattccgtattttctaaatttaaaagggccagcgattcctattgataccgcatgt
tcatcttcattggtcggcactcatttagcgcgccaggcacttataaacaaagaaattgat
atggcgctggtcggcggggtcagcttatacctgacgccggaatcttacatgagtatgtgt
gaggccggcatgctttcacctgatggacaatgtaaagcatttgacaatggcgcgaatggt
tttgtgcccggcgagggtgcgggtgcgctggtattgaaaaggctgaaagatgcggaagcg
gaccgtgaccatatttatggcatcatcattggctcgggtattaatcaggacgggaaaaca
aacggaatcacggcaccgagtgcgaaaagccaaatggatctggaaagagacatatatgaa
acatacggcatacatcctgagagtatcagttatgtcgagatgcacggcacaggaacaaaa
caaggcgatccaattgaattagaagctctgtccaccgtatttcaagaaaaaacagacaaa
aagcagttttgcgcaatcggttccgtcaaaagcaatattggccatacatccgcggcggca
ggagtagccggggttcaaaaagtgttattgtgcatgaatcataaaacacttgtgccgaca
ttgaacttcacgacaccgaatgagcattttgaatttgagcattctcctttatacgtaaat
acggagcttaagccttgggaaacggctgatggaaaaccgcggagagcatgtgtgagctcc
ttcggatatagcggaacgaatgcccatattgtgatagaggaatatcagcctgaaaagagg
aacgatcgattaacaaagcagcaccgctcagcattatttgtactctcagcgaaaaaagag
aagcaattgaaggcctatgcggaagcaatgaaagatttcgtaacttccaatgaagatatc
gatctggaggatatggcatacacacttcagacgggccgggaagcaatggattatcgcatg
gcgtttttggcggattcgagagaaatgctgatcaaagctttagatgattatttggctgaa
atgccgaacggcagcatatttgctgctcacgtgaaaacgaagaagagcgaaatcaagctg
tttgaaacggatcatgatgccaaagcattgctgcaaacatggatagagaaaaaaaggctg
gagaaagtagcagagctatgggtgaaagggctgcagatagattggaacaagctttatggg
gaatacacgcctcgccgaatcagcctgcctgcttatccgttcgcggaagagtattactgg
ctgccaactcaagaaggcgaacccgaaaccattgctacagcaatgcctcaattcgaactg
atgccaaagcgctgctttctgcgtaaacagtggcagccttgtccgattgaaccggcagaa
atgacgaatcaaaccgtcgccattttggcaaatgaggagacaatggcattagcggaagag
ctttcggcgtatttctcgacataccgtatatttgacagccaagagctggatcgggtatct
gctgctgactatgaacacgttgctggagcaatcgatctgatcgggtgcggaacgagccat
gagcattctatgggctggataaactggctccaaaagctgatcgagcaaggacgtgcaagc
aagcatcatttgacggtcttgggtgtaacaaaggggctggaggcctacgcaaatgagggt
gttcttttgtctggtgcttcacgggccggtttataccgcatgcttcaaagtgagtacagc
catcttacttcaagacatgcagatatggaatgcgaagcctctcatgaggagctggccaga
ctgattgcagttgaatattatgccaagagcacagaatcagaagtctgttatcgaaacgga
cagcgatatcgcgcatatttgacagagcagccagcagaagccgctctaagtcataagcaa
gtatcgttttcaacagacaaagtcctgcttattacaggcgggacaagaggtctcggcttg
ctgtgtgcgcggcattttgtgaaaacatacggcgttaagcggctggtccttatcggccgt
gaagagcttccgccgcgtgaccagtggaattcggtaaaaatttcctcgcttgccgagaaa
ataaaagccgttcaagagctagaagacatgggtgcgcaagttcaggtgctgtctctggat
ctcacagacagggttgctgtcgaacagagcctgaagacaatacacgaaacaatgggggcg
attggcggagtcatccattgtgccgggatggtgaacaaacaaaacccggcttttatcaga
aaatcactagaagagatcggacaggtgcttgaaccgaaagtcgaaggtctgcaaacgttg
tttgacctgcttcaagatgaaccattggcgtttttcaccttgttttcatcagtatcagcg
gccatccctgcactagcagcaggacaagctgattacgcgatggcaaatgcttttatggat
tattttgcggaggctcatcaagataaatgtcccattgtaagcattcagtggcctaactgg
aaggagaccggtttaggcgaggttcgaagcaaagctttagaacaaactggattgatcagt
ttgacaaacgacgagggattacagctgcttgaccagattctatcagacagacagtatgct
gtcgtgctgccggcagtaccagatacaaacgtttggaagccggataagctgatgcagccg
tcattgcctgtcgaagctctctcgcatcctgagacgaaagagcaaaccagcactcgcaac
ctgttccctgaaacagtcgactggctcgtaactcttttttcagatgaactgaaaatagct
gcagaagactttgaaacggatgaacctttccaagaatacggaatcgactcgattatattg
gcccagctggtacagcagatgaaccaacaattaaatggagatattgatccgtcaatcttg
tttgaatacccgacaatagaatcctttgcacactggctcatttcgaaatatgacatatca
gctgttttacagccatctgttcctgagaaacagacacctctcaagccgcaatcagcaatg
aaacagaagctggtgccagaacagcggccgcaacagataagccatgaaaaaacggcactt
cttgctgaggacatcgctatcatcggtcttagttgcaggttcccgggagcagaaacccta
gaggaatactgggatttaatacgtgatggacggtctgcgattgcgcctgttccgcctgaa
cgattcgggaactccagctcgaattacgcgggcctcattgatgaaatgaaccgatttgat
catgatttcttcatgatgtccgaaagcgatgtcagagcgatggaccctcaagctttggct
gtattggaggaaagcttgaagctatggtatcacgcgggttatacagagaaagaagtgaaa
ggcatgagggctggtgtttatataggaggccgcagccagcacaagcctgatccggccagt
ctttcaaaagcaaaaaatccgatagtcgctggtggacaaaactatttagcggctaacatc
tcacaattttttgacttgaagggaccgagtattgtcctggataccgcttgttcctctgca
ctggtggggctgaatatggccattcaggctctgcgaagcggagatattgaggcagcggtt
gtaggcggcgtcagtttgcttgatgctgatgcgcatcgaatgtttcatgagcgcggactt
ttatgtgacaaaccgtcattccatatttttgataagcgggcagacggtgtcattttagga
gaaggcgtgggcatggttctcgtcaaaaccgtcaaccaagcggttgaagacggagattcc
atatatgcagtcattaaagccgctgcgattaataatgacggaagaacggcaggcccatca
tctccgaatctcgaggcacaaaaggacgtcatgctgtcagcgcttgaaaaaagcggcaaa
aagactgaagagatcagctatctcgaagcgaacggatcggggtcggcagtaacagattta
cttgaattaaaggcaatccagtccatttaccgttctgaatcaaaggctccgttagggctg
ggatcggtgaaacctaacatcggccatccattatgtgcagagggaattgcgagcctgatt
aaagtagctttaatgctgaagcatagacaattggttccgttcctgtcaggtaatgaaaat
atgccgtattttgatatagaaaaaacagatttgtatttcagcagatcgcaagccgagtgg
aaggagacaacgccggctgcggcaattaattgttttgcagatggcggaacgaacgcccat
ctcattatagaaggttggagagactcggctgagcgtccaattagaagaaaacctctgcct
ttgccggaattaaataggcagcccgttttaatcaaaccatcagctcaaaacgtgcagaaa
aaagtgcattcagacacaggggcttctaaagatatgttttggaaaactttcaaataa

DBGET integrated database retrieval system