KEGG   Bacillus subtilis subsp. subtilis 168: BSU17200
Entry
BSU17200          CDS       T00010                                 

Gene name
pksM
Definition
(RefSeq) polyketide synthase PksM
  KO
K13613  polyketide synthase PksM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU17200 (pksM)
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17200 (pksM)
Lipid biosynthesis proteins [BR:bsu01004]
 Polyketide synthase
  Modular PKS
   BSU17200 (pksM)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   trans-AT PKS
    Bacillaene PksX synthase
     BSU17200 (pksM)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C KR PS-DH PP-binding KAsynt_C_assoc adh_short Thiolase_N Methyltransf_12 adh_short_C2 Methyltransf_23 Methyltransf_25 Methyltransf_11 Epimerase Methyltransf_31 GDP_Man_Dehyd DUF4268 3Beta_HSD DUF3124
Other DBs
NCBI-GeneID: 940026
NCBI-ProteinID: NP_389601
Pasteur: BG10931
BSORF: BG10931
UniProt: P40872
Position
1821553..1834341
AA seq 4262 aa
MITEQLHISLNNPIMSNHKVYGQALLPGLAYIDLIYQVFQEHGYAYQELELKNLTIFYPL
IADESYDIALTIHVSERKEGTWSIIIDGQKQHGESLSDKRQYVTADMHRKEQTAFAESID
LNQWKSTADRILNLDEIYEQCRSQELVHTGMMKAEGQIYEAKEGAVIDLAVGQEALRHSD
AFLFHPTLIDGSGIGSSCLISDQTMYLPLYYESFSASERLQKGCTARILSSSVRQKKELT
YMTIEYFNSAGQKVAELKQFAGKSVRNMSAFHSAKEIQEERAAVSQNISRDYPAFEMYLR
QLLAKQLERPAEQMDIHAGYYELGLDSSSLLTVVQEIGDKVGADLAPTLLFEFTTIAELA
AHLADHYSIGEADDAVRQSPSPIDGVTSSPEIGEDIAIIGMAGRYPKAKNIQEFWEQLKA
GTDCITEIPNSRWEWKESDGLDSPAGKPLSKWGGFIEEADCFDPQFFRISPREAEMMDPQ
ERLFLETCWEAIEDAGYTPETIASPQGENKRQHVGVFAGVMHKDYSLIGAEALSEHNPFP
LSLNYAQIANRVSYYCNFHGPSMAVDTVCSSSLTAVHLAIESIRNGECEAALAGGVNLSL
HPAKYISYGSVGMHSSDGYCHTFGKGGDGYVSGEGVGTVLLKPLRKAEQDGDRIYAVIKG
SAINHVGKVSGITVPSPVAQADVIEACLEKTGIDPRTISYVEAHGTGTSLGDPIEVQGLV
KAFSRNTQDKQFCSIGSVKSNIGHAEAAAGISGLTKTVLQLHHKTLVPSLHSEELNPYLK
LDQTPFFVQHETKEWEQPSFTENGVDVTYPRRAGLSSFGASGSNAHLILEEYIPAESHSE
TILTKNEEIVIPLSARNKDRLQAYALKLLDFLSEDVNLLALAYTMQAGRVEMEERAAFIV
KDIKDLTAKLRAFANGEEEIEGCWTGRAKENQEAAGLASVNALNNNLIRDSEMMEMAKAW
VQGKRVTWDDLYGDRKPLKISVPTYPFARERYWISVPEMKTSTVNHILHPLVHRNTSDFT
EQRFSSVFTGTEFFLSDHVVQGQKILPGVAYLEMAREAAEKAAGDLDGEQRVVSLKDIVW
VRPITIESEPKEIHIGLFPEDNGDISFDIYSSSEHKEEALTIHCQGRAVISDEAETSILN
LSSIQTECSLDTVTSEQCYAAFRKIGLDYGEGYQGIEKVYVGKDQLLAKISLPAFLKNDK
QHFALHPSLMDSAFHATVGFIVSSVNAAGQAQTLSLPFALQEVDIFSPCPEKIWSYIRYS
SDSKAENKVRKYDIDLCDENGRVCVRMKGASMRALDGEQHSKPQLLTDSQLTGHTVMIPV
WEPVSLEAEDNASFAGKRAVLCGAAEADRTFIKHHYPQISFVDIRPADDIEAIADKLQAY
GSIDHVLWIAPSHRGSIGSDGQEEAVLHLFKLVKACLQLGYGEKQLEWSLVTVQAQPVTQ
HEAVQPAHASIHGLAGTMAKEYPHWKIRLLDLEKGCTWPVNHMFALPADRLGHAWAYRNQ
QWHQQQLIPYRSSLSGDTLYRKGGVYVVIGGAGYIGEAWSEYMIRRYQAQIVWIGRSQLN
AAIQSKIDRLSALGPEPFYIAADAADKHSLQQAYEQVKKRHPHIHGIVHSAMVLFEQSLE
KMKPEEFTAGLAAKIDVSIRMAQVFRQENVDFVLFFSSLVAHIKNVKQSHYASGCTFADA
FAHQLSQSWACPVKVMNWGYWGNSEAAEDEHYVQLMNQIGLGLIEPAEAMKALEALLSGP
VSQTAFIHTTKPVAVEGVNQNEFITLYPEQPSADAESLMERLPTTGRFQRVTHEELDDLL
YRLLLGQLQTAELFDGYTLSVERLQQYKTREFYGKWIRQSSEFLLQHGYLKKVGDSLVRK
DQAEDIELLWLEWNAKKEKWLKDSETKAMVVLAEAMLQALPDILTGKVPATDIMFPHSSM
ELVEGIYKHNQVADYFNKVLADTLLAYLDERLKHDPEASIRIMEIGAGTGGTSAGIFEKL
KPYQKHINEYCYTDLSKAFLLHAEKEYGAENPYLTYQLFDVEKPIDQQEFEAGGYDVVIA
ANVLHATKNIRQTLRHTKAVMKNNGMLLLNEMAGNSLFPHITFGLLEGWWLYEDPAVRIP
GCPGLHPDSWKAALESEGFESVFFPAEAAHDLSHQIVAASSNGLVRRMMKNVILPEKVVS
QASNQEPAYIHTIDSEEAGQSKHALLREKSTEYMKKLIGETLKIPAGKIESSEPLEKYGI
DSIVVVQLTNTLRKEFDHVSSTLFFEYQTIDALVEHFIKTKTEALMKLTGLDRQVQQHTP
AESRTQSSQKPDQAAKRTRRFRKLGFSGEKETPTNTLASRDVAVIGISGRYPQAETAEDF
WNNLKEGRNCIEEIPKDRWDWKAYYDKEKGKEGSIYTKWGGFIKDMDKFDPLFFQISPLE
AERMDPQERLFLQTAYASIEDAGYTPDSLCSSRKIGVFAGVMNKNYPTGYGYWSIANRIS
YLLNFQGPSLAVDTACSSSLTAIHLALESIYSGSSDCAIAGGVNLVVDPVHYQNLSVMNM
LSASDTCKSFGDDADGFVDGEGVGAIVLKPLQQAIADGDHIYGVIKASAINSGGKTNGYT
VPNPHAQAQVIKEAIERADIPARTISYLEAHGTGTALGDPIEIAGLTKAFEKDTQEKQFC
AIGSSKSNIGHCESAAGIAGLTKILFQFKYGQIAPSLHAQRLNPNIEFSHTPFVVQQQLG
EWKRPVIGGQEVPRRAGLSSFGAGGSNAHIILEEYIPRTGAQTPKDHPPALIVLSAKNME
RLQEKAEQLLTAIKQKRYCETDLIRIAYTLQTGREAMEERLAFIAESLEDLERKLNDFIE
NKADSLYLDRIDDNKKALAVLSADEDTEKIIEAWMSKGKYTKLLDLWVKGLSFDWGMLYG
TQTPVRISLPAYPFAKERYWAPGAAKAPVSIEQDHDQQTEEPFKVMTFQEVWKEEPATLT
SKRIKTLICFLTEREKQNAFASALKNVDQDTKVIFISQGEVYSKQSEYSYQIVRQEPVTF
EKAFQSIKEELGEPDAILYMWPMEDKRCIKDHSCIVYLLQGMSAAKLHPSRLLLAGCFED
SLDRSYLESWIGFERSLGLVLPHTKVTGIFQPAEQGSMDDWTRKVWAELQASTEQTVLYQ
NLKRYVNHIEQTTIQPDNSKLKSGGTYLITGGVGGLGYLFAKHLAKNYAANLILTGRSPF
NDEKQKQIKELKDLGGEAMYAEADVSDPIAMGDCVKRGKDRFGAINGVIHAAGIESDSAI
FDKKIESFQRIIEPKINGTIALDEWLKNEDLDFMCYFSSSSAVLGDFGCCDYAIGNRFQM
AYAQYRNELHNGKTFVINWPVWKDGGMKIGDEETTDMYLKSSGQRFLEAEEGIRMFEHIL
AQQDAQHLVIAGQPSRVSRFLGMTEPAIPEPATQAPLAQENKDEVKTLSIEKRLEHDLKE
HIHTLLKISKDKLNLNKNWADFGFDSIYLAKFSNVLSKHFNIEVTPALFFGYSTLQELIS
FFLTDHKELIEAFYRDDASEAQKPPEAYAVIPVALEPEASKKSIRQVHDEPIAIIGMSGR
FPQADSVHELWDNLKNGKSCISDIPGERRDWGRANRDPEKAVPRWGAFLKDIDRFDPLFF
QISPKEAESMDPRQRIFLEEAWHTFEDAGYMGDRIKGKSCGVYVGVEEGEYAHLTGDTDY
INGTQNATLSARIAYALDLKGPNMALTAACSSGLVAIHQACSALRQGDCEMALAGGVSLN
ISHMSFEALTRAEMLSPNGQCKVFDQDANGLVPGEAVAAVLLKPLSKAIEDKDHIYGCIK
ASGVNYDGKTNGITAPNPFSQAELIENIYEKNEINPLDIQYVMAHSTGSNLGDPLEVQAL
TSVFSKYTKQKQFCMISSIKPLIGHTFAASGTVALISMLMAMKNQIIPATHHCESENPYI
PFKESPFVLCKENRSWIKKNQKPRMGTISTTGISGTNAHAVIEEYIPDDQPSTQRHQGSP
QIFVISAQNDDRLQDAACRMIAYLEQNHNLSLPDVAYTLQVGRKAMEARLAIVANNQEQL
VRKLKEYVEAMKNGGVSGQQRSLYTGYTEGILEEQDEAVLQALAKERNLENIAECWVKGY
QIPWELLHDGDDVRMVSLPGYPFARERYWISSGTQQSEAVKQHSQDMKTEIDEPNGKTHI
QKIIVQFLARELGISEDRINFKRNFLDYGMDSILGRKLMRHIEKTTQLKMAGREILECQT
VQALSDHLALKAEKQNHSAAAHHIKGTYTDEQIIGLMQEVALGKLDFKSVQNIIEGSKSY
ES
NT seq 12789 nt   +upstreamnt  +downstreamnt
atgataactgaacaactgcacatttcattaaataatccaatcatgtccaaccacaaggta
tatggacaagcgttattacccggccttgcttatatagatttaatctaccaagtattccag
gaacatggttatgcataccaagagcttgaattaaaaaacctaaccattttttaccctttg
atcgcagatgagtcatatgacattgccctgaccattcacgtgtctgaaagaaaggaaggg
acatggtccatcatcatcgacggacaaaaacagcatggagaatcactatctgacaagaga
caatatgtgactgctgacatgcatcgtaaagagcaaaccgcttttgccgaatcaatagac
cttaatcagtggaaaagtacagctgacaggattctgaatttagatgaaatctatgaacaa
tgccgatctcaagagttagtgcataccggcatgatgaaggcggaaggacagatttatgaa
gccaaagagggggctgtaattgatttagcagtcggacaggaagcattgcgtcattctgat
gcttttctgtttcatccgacgcttattgacggcagcggcataggttcaagctgcctgatc
tcagatcaaacgatgtacctgccattgtattatgaatcgttttctgcttcagaacgattg
caaaaaggatgtacagcacggatcctctcctcatctgtgcgccaaaagaaagaactcact
tatatgacgattgaatattttaattcagcaggacaaaaagtggccgagctgaaacaattt
gcaggcaagtctgtacggaatatgtcagcctttcattctgcaaaagaaattcaagaagaa
agagctgctgtctctcagaacatcagtcgggactatcccgcatttgaaatgtatttgcgt
cagctgcttgctaagcagcttgaaaggccggcagaacaaatggatatccacgctgggtac
tatgagcttggtctggattcttcgtcattgcttaccgtggttcaggaaattggagataag
gttggggcggatcttgctccgacactgctgtttgaatttacaacaattgcagaactagct
gctcatcttgctgatcactattcaattggagaggcggacgatgctgtccgccaatctcct
tcaccaattgatggtgttacctcttcaccagagatcggggaggacatagccattatcgga
atggcgggacgctatcctaaggcgaaaaatatacaggaattttgggaacagcttaaagcg
ggtaccgactgcatcacagagattccaaactcacgctgggaatggaaagaaagcgatgga
ctggattcacctgcaggcaagccgctctcgaaatggggcggctttatcgaggaggctgat
tgctttgatcctcaatttttcagaatctctccgcgtgaagcggaaatgatggaccctcag
gaacgcttatttttagagacgtgctgggaagctattgaagatgcgggttatacaccagag
acaattgcttcaccgcagggagaaaataaaagacagcatgtcggtgtgtttgccggcgtt
atgcataaggactattctcttataggagctgaagctctatcagaacacaatccatttcct
ttatcgctgaattatgcgcaaatcgccaacagggtctcttactattgtaatttccacggc
ccaagcatggcggtggacacggtctgctcttcctcattaactgcggttcatctggcaata
gagagcatccggaatggagaatgcgaggccgcgcttgccggaggcgtcaatttgtcactg
catccggctaaatatatcagctatggcagtgtagggatgcactcaagtgacggctattgc
catactttcggcaaaggcggggatggctacgtatctggagaaggtgtcggcacagtattg
ctaaaaccgctgcgaaaagctgaacaggacggtgaccgaatctatgctgtcatcaaaggc
agtgcgataaatcatgtaggaaaagtaagcggaattacagtaccgagcccggtagctcaa
gctgatgtaatcgaagcatgtctagaaaaaacaggaattgatccgcgcaccatcagctat
gttgaagcccatggcactggcacctcattgggagatccgattgaagtacaggggttagta
aaagctttcagccgcaatacgcaggacaagcaattctgttcaatcggttctgtgaaatca
aatattggccatgctgaagctgcagccggcattagcggcttaacgaagactgtcctgcag
ctgcatcataaaaccttggtgccgtcattacattcagaagagctgaatccttatttgaag
cttgatcaaaccccattttttgtccagcatgaaacaaaggaatgggagcagccatctttt
acagaaaacggggtggacgtcacatatccccgccgtgccggtttaagttcgtttggcgct
tcaggatcaaatgcgcatcttattttggaagaatatattccggcagagagccattcagag
acgattttaacgaaaaatgaagaaatagtgatacctttgtctgcgagaaacaaagatcgt
ctgcaggcttacgctcttaaacttcttgattttcttagcgaggacgtcaatcttttagcg
ttagcttataccatgcaggcaggacgggttgaaatggaggagcgtgcggccttcattgta
aaagacataaaagatttaacggctaaacttcgggcgtttgccaatggcgaagaagagatc
gagggctgctggaccggacgagccaaggagaatcaggaggcggctgggctagcatcggta
aatgcgctgaataacaatttgataagagacagtgaaatgatggaaatggcgaaagcatgg
gttcaaggaaagcgggtcacctgggacgacctatacggcgatcgcaagccgcttaagatc
agtgttccgacctatccgtttgcaagggagcgctactggatctcggttcctgaaatgaaa
accagcactgtgaatcatatcttacatccgctggtgcaccgcaatacatcagactttact
gagcagcgctttagctctgtatttacaggcacggaatttttcctgtcagatcatgttgta
cagggacagaaaattttgccgggcgttgcctatttagaaatggcaagggaagcagcggaa
aaagctgcaggcgatctggacggcgaacaaagagtggtgtcgcttaaagacattgtgtgg
gtgcgtcctatcacgatagaaagtgaaccaaaagaaatacatattggcctttttcctgag
gataacggggacatttcctttgatatttatagcagctctgaacataaagaagaagccctg
acgatacactgccaaggtcgcgctgtcatttcagatgaagcggagacttccattttaaac
ctttcatcaatacagacagaatgcagcctggacacagtgacgtcagaacaatgctatgca
gcgtttcgaaagattgggcttgactatggcgagggctatcaagggattgaaaaagtctat
gtcggcaaagatcaattgcttgcaaaaatctcgttacccgcttttctaaaaaacgacaag
cagcattttgcgctccacccgagtttgatggattccgcgttccatgccacagtcggtttt
atcgttagctcagtcaatgccgctggacaagctcagacgctgtctcttccatttgcgtta
caggaggttgatattttcagcccatgtccagagaagatatggtcttatattcgatacagt
tcagacagtaaagcggagaacaaagtcagaaagtatgacattgatttatgtgatgagaac
ggacgtgtttgtgtgcgaatgaagggtgcctcgatgcgggcacttgatggagagcagcat
tcaaagccgcaactattaactgattctcagctgaccgggcatacggtgatgatccccgtc
tgggaaccagtctctctagaagcggaggataatgcttcgtttgctggtaaaagagctgtt
ttatgcggagctgctgaagctgatcggactttcataaagcatcattatccgcaaatttcc
tttgtcgatatccgccctgcagatgacattgaggcaatagcggacaaactgcaagcgtac
ggaagcattgaccatgtattgtggattgccccgtcacaccggggaagtataggtagtgat
ggacaagaagaagctgttcttcacttatttaagcttgtgaaagcatgcctgcaattaggc
tatggcgagaaacaacttgaatggtctcttgtgaccgtccaagcgcagccggttacgcaa
catgaggcagtacaacccgctcatgcaagcattcatgggcttgccggcacaatggcaaag
gaatatccacactggaaaatccgtcttctcgatcttgaaaaaggctgcacatggccggta
aatcacatgtttgcgctcccagctgaccgccttggccatgcttgggcctatcgtaatcag
caatggcatcagcagcaattgatcccatatcggtcctcactgtcaggcgacacgctatat
cggaaaggcggagtctatgtggtcatcggaggagccgggtatatcggagaggcgtggagt
gagtacatgatccgccgctaccaggcgcaaatcgtttggattgggcgaagtcaacttaat
gctgccatccagtcaaaaatagaccgactttcggcgcttggccctgagcctttctacatt
gcagccgatgcagccgataagcattcactgcagcaggcttatgaacaagtgaaaaaacgt
catcctcatattcacgggattgttcactctgcgatggttttatttgagcaaagcctggaa
aaaatgaagccggaagaattcaccgctggactggcggcgaagatcgatgtcagtattcgg
atggcccaagtgttccgccaggagaatgtagattttgttttattcttctcttcgcttgta
gcccatatcaaaaatgtgaagcaaagccattatgcctctggctgtacatttgcagatgct
tttgctcaccagctttctcagagctgggcatgccctgtaaaagtcatgaactggggatat
tgggggaatagtgaagcggctgaggatgaacattatgtacagctcatgaatcaaatcggc
ttaggtttaattgagcccgcggaggctatgaaggcgctggaagcactgctttctgggcca
gtcagccaaacagctttcattcatacgacaaagcctgtagcagtcgaaggcgtgaatcag
aatgaattcatcactctttatccagagcaaccttcagcagatgcagagagcctgatggag
cgtctgccgactacgggacgatttcaaagagtgacacatgaagagcttgatgatcttctt
tacaggctgttgttaggacagctgcaaacagccgagctgtttgatggttatacattatcg
gttgaacgtcttcaacaatataagactcgtgaattttatggaaaatggattcggcaaagc
agcgaatttctcttgcagcatggctatcttaagaaagttggagattcattggtgaggaag
gaccaagcagaggatatcgagctgctttggctagaatggaacgcgaaaaaagaaaagtgg
cttaaagacagcgagacaaaggcgatggttgtattagcagaggccatgctgcaagcatta
ccggatattttgacagggaaagtccctgcaacagatatcatgttcccgcattcctcgatg
gaactggtggaaggcatttataagcataaccaagtggcagactattttaataaagtgctt
gccgatacattattagcttatctggatgaacgtctgaagcacgaccctgaggcatcgatt
cgcattatggaaataggcgcaggcacaggcggcacgagtgccggaatctttgaaaaactg
aaaccatatcaaaagcacatcaatgaatattgctatacagatctgtctaaagcatttttg
ctgcatgcagaaaaggaatatggggcggaaaatccgtacctgacatatcagctttttgat
gtggaaaaaccgattgatcagcaggaatttgaagcgggaggctatgatgtcgtcattgcc
gctaatgtccttcacgcaacaaaaaatatccgtcaaacactgcggcatacaaaagcggta
atgaaaaacaacggaatgctgctgctgaatgaaatggcgggaaacagcctgttccctcac
atcacctttggtcttttggaaggctggtggctgtatgaagatcctgcagtgcggattccc
ggctgtccaggcttacatcctgacagctggaaagcggcacttgaaagcgaaggctttgaa
tctgtctttttcccggccgaggcggcacatgatctgagtcaccaaatcgtcgcagcctca
agcaacgggctggttcgacgtatgatgaaaaatgtgatcttgccggagaaggttgtttca
caagcgtctaatcaggagccagcctacattcataccatagattcagaggaagctggacaa
tcgaaacatgctctcctaagagaaaaaagcacagaatatatgaaaaaactaatcggggaa
acgttgaaaattcctgcaggaaagattgagtcatctgaacctcttgaaaagtacggtatt
gattctatcgttgttgtccagctgacgaatacattgcgtaaagaatttgaccatgtaagc
agcactttatttttcgagtaccagaccattgacgcattagtggagcatttcatcaaaaca
aaaacagaagctctgatgaaattaacaggtcttgaccgtcaagttcaacaacatacaccg
gccgaaagcagaacccaatcttcacagaaacctgatcaggccgctaaaagaacacggcgc
tttcgcaagcttggcttcagcggggagaaagaaacaccgacaaacactcttgcaagccgt
gacgttgccgttatcggcatttctggacgctatcctcaggcggaaacagcagaagacttt
tggaacaacctaaaagaaggaagaaattgtattgaggaaattccgaaagatcgctgggat
tggaaagcttattacgataaagaaaaaggaaaagaaggatcaatttatacgaaatggggc
ggatttatcaaggatatggacaagtttgacccattattctttcagatttctccgcttgag
gcagaaagaatggaccctcaggagcgattatttctgcaaaccgcttatgcaagtattgaa
gacgcgggatacacgcctgactcgctctgttcaagcagaaaaatcggcgtctttgccgga
gtcatgaacaaaaattatccgactggctacggctattggtctatcgccaacagaatatcc
tatttactgaatttccaaggcccgagtcttgcagtcgatacagcctgctcatcctccctg
acagcgattcatttagcgctggaaagcatctatagcggatcgagtgattgtgccattgcc
ggcggtgtcaatttagttgtcgacccggttcactatcagaatttatctgtcatgaatatg
ctctctgctagtgatacatgtaaatcattcggcgatgatgcagatggatttgtcgacggt
gaaggcgtaggcgccattgtgttaaagccgctgcagcaagcaatagcggacggtgaccat
atttacggtgtgataaaggcaagtgccattaatagcggaggaaaaacaaatggatacacg
gttccaaatcctcatgcacaggcacaggtgattaaagaagcaattgagcgcgccgacatt
cctgcccgaaccatcagttatttagaggcgcatggaacaggcactgcattaggagatccg
attgagatagcggggttaacaaaagcattcgagaaagatacgcaggagaaacagttttgt
gcgatcggctccagcaaatcaaatatcggccattgtgaaagtgcagccggaattgcaggg
ctgacaaaaatactttttcagtttaaatatggccaaattgcgccatcattgcatgctcag
cggttgaatccgaacatcgagttcagccatacgccatttgtcgttcagcagcaacttggt
gaatggaaacgcccggtgattggcgggcaagaggtgcctaggcgcgctggcttgagcagt
tttggcgccggagggtccaatgcccatatcatcctggaagaatatattccaagaacgggg
gcgcaaacgccgaaagaccatcctccagcgctgattgtgctgtcggccaaaaacatggaa
cgtttgcaagaaaaagcggaacagctgcttacagccatcaaacaaaaaaggtactgcgaa
acagacctgatcaggatcgcctataccttgcaaacaggccgtgaagcaatggaggaacgg
ctggcctttatagcggaatcactagaggatcttgagagaaagctgaacgattttatcgaa
aacaaagcagacagcctgtatctggatcgcatcgatgataacaaaaaagcgttagcagtc
ttatcagcggatgaggatacggaaaaaatcatagaagcatggatgagcaaagggaaatac
acgaaactgctggatctttgggtgaaaggcttgtctttcgactggggcatgctgtacggc
acccaaacgcctgtccggatcagtcttccggcatatccatttgcaaaagaacgttactgg
gcaccaggcgcggcaaaggccccggtgtctatagaacaggatcatgatcagcaaacagaa
gaacctttcaaggttatgacgtttcaagaagtgtggaaagaagagccggcgactctcaca
tcgaaacgtatcaaaacgctcatctgttttctgactgaaagagaaaagcaaaacgcattt
gcttcagccctgaaaaacgttgatcaagacaccaaggtcatttttatatcacagggcgaa
gtgtacagcaaacagtctgaatatagctaccagattgtgcggcaagaacccgttactttt
gaaaaggccttccagagcattaaagaagaacttggagagccagatgcaatcctctatatg
tggcctatggaagacaagcgctgtataaaggaccattcctgtattgtttacctattacaa
ggtatgtccgcagcaaagcttcatccttcacggctgctgctggcaggatgttttgaagat
agtcttgaccgaagttatctggaatcatggattggcttcgaacgttcactcgggcttgtc
cttccgcacacaaaagtgactggaatctttcagcccgcggaacaaggatcgatggatgat
tggacacgtaaagtctgggcagaattacaggcttcaactgaacaaacggttttgtatcag
aatctgaaacgatatgtaaatcacattgaacagacaacgatacaaccggacaacagcaaa
ttgaagtctggcggtacttacctgattacaggcggtgtaggagggcttggttatttattt
gccaagcatttggccaaaaactatgccgcaaacctgattttgacagggaggtcgcctttt
aatgatgagaagcaaaagcaaataaaagaattaaaggatctaggcggcgaagcgatgtat
gcagaagcagatgtgtctgatcctatcgcaatgggagactgcgtaaaaagagggaaagac
cgattcggtgccatcaacggtgttattcatgcagccggaatcgagagcgactctgctatt
tttgacaaaaagatcgaaagcttccagcgcatcattgaaccgaaaatcaacggcacgata
gcgcttgatgaatggcttaaaaatgaagaccttgattttatgtgttatttttcttcttct
tctgcggttttaggggattttggatgttgtgattatgcgattggcaataggtttcagatg
gcttacgcacaatacagaaatgagctgcataacggtaaaacgtttgtcatcaactggcct
gtgtggaaggatggcggaatgaagatcggtgatgaggaaacaacggatatgtacctgaaa
tcaagcggccaacgcttcctagaagccgaggaaggtatccgtatgtttgagcacatccta
gctcagcaggatgctcagcatctcgtgatagccggtcagcccagccgtgtcagcagattt
ttaggaatgactgaaccagctattccagaaccggccactcaagcccctctagcacaagaa
aacaaggatgaggtaaaaacactaagcattgaaaagcgtttagaacacgacttgaaagag
catattcacacattgcttaagatttcaaaggacaagctgaatttgaacaaaaattgggcc
gacttcggatttgattcgatctatttggctaaattctcgaacgtgttatcaaagcatttc
aacatcgaagtgacaccggctttatttttcggctattcaactttacaagaattgatcagc
tttttcttaaccgatcataaagagctgattgaagcattttaccgggatgatgcatcagag
gcgcaaaagccccctgaagcttatgcagtaattcctgtagctttagaaccagaagccagt
aaaaaaagcattcggcaggttcacgatgagcctattgccattatcggcatgagcggcagg
ttccctcaagctgattcggtccatgagctgtgggataatctgaaaaacggtaaatcgtgt
atctctgacattccgggcgaacgccgggactgggggagagctaacagagatccagaaaaa
gcagtgccaaggtggggtgcatttttgaaggacatagaccggtttgatccgctgtttttt
caaatatcgcctaaagaagccgaaagcatggacccgcgtcagcgcatttttctagaggaa
gcatggcacacgtttgaagacgccggctatatgggagatcggataaaaggaaaatcctgc
ggtgtttatgtaggtgtggaagaaggggaatatgcgcatctaaccggagatacggattac
attaacggaacacaaaacgccacattgtctgcgagaatcgcatacgcattggatttaaaa
gggcctaatatggctttgacagcagcatgttcatctggactggtggcgattcaccaggca
tgttcagctctgcgtcagggggattgtgaaatggctttagcgggcggcgtcagcttgaat
atttctcacatgtcttttgaggcgctgacaagggccgaaatgctgtctccgaacggacaa
tgcaaagtgtttgaccaggatgccaatggtcttgtgccaggtgaagcggtggctgctgtt
ctcttgaaaccattatcaaaggcaattgaagataaagatcatatttatggctgcatcaag
gccagcggcgtgaattacgatggcaaaaccaacggcattactgcgccaaatccttttagc
caggcagaattgatcgaaaacatttatgaaaaaaatgaaatcaatccgctcgatattcaa
tatgtgatggcgcacagtaccggctcgaatcttggtgatccgcttgaggtccaagcgtta
acgagcgtgttcagcaaatatacgaagcagaagcaattctgtatgatcagctcaattaaa
cctttaatcggacatacatttgcagcgtcaggaacggttgctttaatcagtatgctgatg
gctatgaaaaaccagatcattccggccactcatcactgtgaatcggaaaacccgtatatt
ccgtttaaagaaagcccatttgtgctttgcaaagaaaaccgttcgtggatcaagaaaaat
cagaagccgaggatgggaacgatcagcacgactggaatcagcggcaccaatgcacatgca
gtcattgaagaatacattccggatgatcagccgtccacacagcggcatcaagggtcaccg
cagatctttgtgatttcagcccaaaatgacgatcggcttcaggatgctgcctgccgcatg
attgcgtatctggagcagaatcataacctttctttacctgatgtggcatatacgcttcag
gttgggagaaaagccatggaagcaaggctcgcgatcgttgcaaacaatcaggagcaattg
gtgcgaaaattgaaggaatatgtggaagcaatgaagaatggtggggtatcaggccaacag
agatccctttatacaggatatacagaagggattttagaagaacaagatgaagcagttctg
caagctctcgcaaaagaaagaaatttggaaaacatcgcggaatgctgggtgaaaggatat
cagattccttgggaactccttcatgatggcgatgacgttcggatggtttctttacctggt
tatccatttgcaagggaacggtattggatttcgtcaggcactcagcaatcagaggccgtt
aaacagcattcacaagatatgaaaacagagattgacgagccgaatggcaaaacccatatt
caaaagatcattgttcaatttttagcacgagaattgggcatatctgaggatcgaatcaat
ttcaaaagaaacttcctggattatgggatggattcaattcttggccgaaaattgatgcgg
catatcgaaaaaaccacgcagctgaagatggccggccgggaaatccttgaatgtcagaca
gtccaagctctatctgaccatttggccttaaaagcggaaaaacaaaatcatagcgcagca
gcacatcacataaagggcacgtatacagacgagcaaatcattggattgatgcaagaggtg
gcgctagggaaattggattttaagagtgtgcaaaacatcatagaagggagtaaatcgtat
gaatcataa

DBGET integrated database retrieval system