KEGG   Bacillus subtilis subsp. subtilis 168: BSU17210
Entry
BSU17210          CDS       T00010                                 

Gene name
pksN
Definition
(RefSeq) polyketide synthase PksN
  KO
K13614  polyketide synthase PksN
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU17210 (pksN)
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17210 (pksN)
Lipid biosynthesis proteins [BR:bsu01004]
 Polyketide synthase
  Modular PKS
   BSU17210 (pksN)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   trans-AT PKS
    Bacillaene PksX synthase
     BSU17210 (pksN)
SSDB
Motif
Pfam: ketoacyl-synt PS-DH KR Ketoacyl-synt_C AMP-binding Condensation PP-binding KAsynt_C_assoc adh_short adh_short_C2 Thiolase_N AMP-binding_C
Other DBs
NCBI-GeneID: 940054
NCBI-ProteinID: NP_389602
Pasteur: BG12652
BSORF: BG12652
UniProt: O31782
Position
1834409..1850875
AA seq 5488 aa
MKRQLKSPLSEGQKGLWMLQKMSPGMSAYNIPLCFRFSKPIHAETFKKALLFVQRQYPVL
ASVIQEENGIPFQSVQLSKDLYFVEEDISAMKSADIMPFLKEKAKEPFQLEAGPLWRTHL
FHRLEECIVLITIHHIIFDGVSMLTLISALFEAYQQLLNGIEPLQQPSTADYYDFVDWEN
RMLTGREGEEHLAYWKEQLSGSLPVLDLPADRPRSSARKFKGQAYKSLLPHHLRNQIKSF
ARTNHVNESVVFLSIYKVLLHHYTKQKDIIVGVPTMGRQEDRFETLIGYFINMMAVRSKN
IGSQPLTAFIRELQLTVAVGLDHAAFPFPALVRELNVDRSAADSPVFQTAFLYQNFFQAT
GLQKVLEPYQTLGIEYIEDIRQEGEFELALEIYEQENETVLHLLYNPDLYELSSIESMME
NYMKLAQHMMEDPSLPLEAYSLQLNQEQTSLLEQWNATGTNIANDKCIHEVFEEKAKQTP
DAVAVMFEDRSLTYKEVDEKSTSVAVYLQHQGVRPEQPVGICAERSFDMIIGILGILKAG
GAYVPLDPSFPQERLKYMLKDSQASIVLTQPNVHDRISGLTGSHVKAINIELACRNGYTD
QQSSGLKREVKPEHLAYIIYTSGSTGEPKGVMVEHRSIMNTLNFLESHYPVTAEDAYLLK
TNYVFDVSISELFGWFIGDGRLVILPPNGEKSPQLCMDYIETYKVTHINFVPAMLHVFLE
MAKDNKRFTEDGPLKYMMVAGEAFPKVLVKKAVSLFTNCRVENIYGPTEASIYAAYFGCG
KGDIASHHTPIGKPVSNTKIYIVDQHLKPVPIGKPGELCIAGAGLARGYFKKPGLTAEKF
IDNPFESGTKLYKSGDSARWLPDGNIEYLGRIDSQVKIRGFRVELGAIETKLGEFPGILD
QAVVVKQLEGHQQLAAYYTEESGHASANPKDLRLHLKSSLPEYMIPSHFIRLDELPLSPS
GKVNRKELEKREIVFNRRKPNHLQLTEIEDQVLRIWEETLKVSGFGPEDGFFDAGGDSLL
AVAVAERIKKEFDCEFHVTELFEYSTIRAISEYILEMKNSDLAGTQNEDDHDDKKDGKYP
KQKIPPYFDDSVAIVGISCQFPGAKNHHDFWNHIKEGKESIRFFSEEELRANGVPEELIQ
HPDYVPVQSVIEGKDLFDPGFFQISPKDAEYMDPQLRLLLLHSWKAIEDAGYVAKEIPAT
SVYMSASSNSYRTLLPKETTEGHESPDGYVSWVLAQSGTIPTMISHKLGLKGPSYFVHSN
CSSSLVGLYQAYKSLTSGESQYALVGGATLHAQSAIGYVHQNGLNFSSDGHVKAFDASAD
GMAGGEGVAVILLKKAVDAVKDGDHIYAIMRGIGINNDGAEKAGFYAPSVKGQTEVIQHV
LDTTKIHPETVSYIEAHGTGTKLGDPIEMSALNKVYKQYTDKTQFCGIGSVKTNIGHLDT
AAGLAGCIKVAMSLYHNELAPTINCTEPNPDIKFESSPFYVVRERKSLEKHAGVHRAALS
SFGLGGTNAHAIFEQYENISDAGAENEGNQPYIIPISAKNSERLQVYAKEMLSYISQDEQ
RHFSLRDIAYTFQVGREAMDNRIVFIVNDLEEWKHQLEAFVTGKPLAEGCIQGEKTRMTS
AEQLLGNAEADDMASSRISKEELRKLAEMWANGFHVEWRRLYPNIKPRRISLPTYPFAEE
RYWPESSTGAITTIEPSRLHPLVHHNTSVLSEQRFSSIFTGQEYFIAEHIIKGMAILPAA
VTLEMARAAIEQGIGGLEDHETGIRLKNVVWVRPVVAGSEPVQVNIGLYDEDGGHIAYRM
YGDPESADAEPVVYNQGKAELIQLKREKALDLSKIKKQCDQSKMDAASFYEGMIGADYGP
GYKSVEAVYKGDGQLLAKLSLPESVAHTLGDYVLHPSVMDGALQAAEYLQNVVRAELSDT
EDFKAALPFALEELEVFRQCVSDMWVYVQFNSKNKPGDLIQKVDIHLCDEHGMICVRLKG
FSTRVMEADIQTEPSKINAETLLLQPVWQEQKAANSLAAKKYAEHLVFLCEYDHETRKQI
EAAIEDVHVYSLEARPSSVDGRFHSYTEQVFKKVQEIIRTKPKDGILVQIVTSAEGEQQL
FSGLTGLLKTACQENAKLTGQMIEVSSEESGESIAGKLLENQMSSDSYVKYQNGTRYIAD
WREIKQAKGDGSKPWKDNGVYLISGGAGGLGHIFAKEIAEQTKNATVILAGRSPLSESKS
KKLKELHSKGADITYRQTDVTNKIEVYQLIDDIQKRYGRLNGILHSAGIIKDSYLVNKQA
KDLHDVLAPKVKGLVYLDEASKDLPLDFFILFSSLSGSLGSIGQSDYAAANVFMDMYAGY
RNRLADLSQRHGQTLSVNWPLWRDGGMQVDQETEKRLVQLAGIVPMRAEKGIQALYQALH
SEANQVMVIEGDVQKIKQNMLAKNASAPMEKKEAEHMTEQINSIDADSLLDKVKAMLKRE
IAKLLKVKLETIDDHAEMTVYGFDSISMTEFTNHINRAYQLELTPTVFFDHPTIHAFGKH
LSEEYQSVFAKTFAVRAVSAQLQPAAKQEQAVRAKAKRRRKQQVMLPNAIQSDAGPEPIA
IVGISGIFPMAKDVEAYWNILKEGKDCMTEIPKDRWDWREYEGDPAKEVNKTNVKWGGFI
DGIADFDPLFFGISPREAEQMEPQQRLLLTYAWKAIEDAGYSAKRLSGTKTGVFIGTGNT
GYSSLLSKANSAIEGSAAANTSPSVGPNRVSYFLNLHGPSEPVDTACSSSLVAIHHAISS
IEEGTCDMALAGGVNTIILPEVYISFDKAGALSKEGKCKTFSNQADGFAHGEGAGILFLK
KLKAAEEAGDHIYGVIKGSAINHGGRAASLTTPNPKAQADVIQSAYQKAGIDPKTVTYIE
AHGTGTELGDPVEINGLKSAFKALGVNEGDTSANPYCGLGSVKTNIGHLSLAAGAAGVIK
ILLQLKHKTLVKSLHCENVNPYIQLKNSPFYIVRETEEWKALKNEQGEELPRRAGVSSFG
IGGVNAHVIIEEYIPEASDENIPSIAPEHPGIFVLSAKNEARLKEHAQQLADALDKQTYS
DVNLARIAYTLQAGRDAMEERLGIISGSIEDLQKKLKDFAAEKSGVEDVFKGRIDKGTLQ
MLTEDEEIQEAVEKWMERGKYAKLLELWVKGLDVDWTKLYGENLPKRISLPTYPFAKDRY
WISDHIEKSGSIDANQAASRLGGAVLHPLMHQNTSNLSEQRFSSIYTGEEFFLADHVVKG
QRILPGVAHLELARAAVEQAAEVQGVPRIMKLKNAVWVRPIVVEDQPQQVHIRLLPGENG
EISYEIYGHSDVTGEQSIVYSQGSAVLNPAENLPAVDLQSLREQCQESHFSVNEVYDTYR
MIGFEYGPAYRGVKKIYTAEQFVLAKLSLHPSAADTLSQYKMHPGLMDSALQASSILTGA
GDNQLTLPFAVQELEVFGACSSEMWVYARYSQGSKATDKVQKRDMDILDESGNVCVRMKG
LSFRAAEGGSGSAESDQTLATLMFEEKWVPKDFKKESPEPHYERHIVMLCDMNGLSKDRI
ESRMTGAECIVLESFREGLAERFQDYAEQALETVQGLLKSRPQGNVLIQLLTSAQRKQYS
FSGLSALLKTAGLENKKLIGQTIEIDSHENVESVIEKLKENKRHTEDQHIKYEKGKRYIN
DLDEMQIDDREISMPWRDKGVYLITGGAGGLGFIFAKEIARQAEQPVLILTGRSALNADQ
QAELNELQQLGARAEYRQVDVTQTEAASELITSITSDYEDLNGVIHSAGLIKDNYLMSKT
NEELTQVLAPKVKGLVNVDEATEHLALDFFILFSSISSVAGSAGQADYAMANAFMDSYAA
YRNALVTAMYRHGQTLSINWPLWKEGGMRANKEIENMTLKNTGVTPMRTETGIQALYKGL
AFGKDQVIVMEGFKDMMREKLTQKPSSDDVPMKTVQVRVTSEARMDQGNMFDHIQEVLKQ
TISQLLKIKPEEIDPDMEFNQYGFDSITLTEFANTLNEKCKLDLTPTVFFEHATVYAFAG
YLSEEYPNAFTAQTPAKAEVLMQPVEQNIKNMTFSTENRFVKPSVTPMQKEADHKPEPIA
IVGMSGVFPKAKDVEEYWKNLSSGADCITEVPKDRWDWQEYYGDPLKEANKTNVKWGGFI
DEVADFDPLFFGISPLEAEQMEPQQRLLMTYAWKAVEEAGHSARSLAGTKTGIFIGTGNT
GYSSLLSNVDIEGSAAANMSPSAGPNRVSYFLNIHGPSEPIDTACSSSLVAIHHAVCAIE
NGNCEMAIAGGVNTVVTPQGHIAYDKAGALSKEGRCKTFSDKADGFAVSEGAGILFLKKL
TAAERDGDHIYGVIKGSAVNHGGRANSLTTPNPKAQADVVKTAYEKAGIDPRTVTYIEAH
GTGTELGDPVEINGLKAAFKELYEKTGDPAVHGSHCGLGSAKTNIGHLSLAAGVAGVIKV
LLQLKHKTLVKSLYSETVNPYIRLDDSPFYIVQESREWQALRDEAGRELPRRAGISSFGI
GGVNAHVVIEEYIPKETTHPATAPAVTAQHPGIFILSAKDEDRLKDQARQLADFISKRSI
TARDLTDIAYTLQEGRDAMEERLGIIAVSTGDLLEKLNLFIEGGTNAKYMYRGRAEKGIA
QTLRSDDEVQKTLNNSWEPHIYERLLDLWVKGMEIGWSKLYDGKQPKRISLPTYPFAKER
YWITDTKEEAAAHQTALKTVESAALHPLIHVNTSDLSEQRFSSAFTGAEFFFADHKVKGK
PVMPGVAYLEMVHAAVTRAVRRTEDQQSVIHIKNVVWVQPIVADGQPVQVDISLNPQQDG
EIAFNVYTEAAHNDRKIHCQGSASIRGAGDIPVQDISALQDQCSLSTLSHDQCYELFKAI
GIDYGPGFQGIDRLYIGRNQALAELSLPAGVTHTLNEFVLHPSMADSALQASIGLKLNSG
DEQLSLPFALQELEIFSPCTNKMWVSVTSRPNEDKIQRLDIDLCDEQGRVCVRIKGITSR
LLEEGIQPPDGPTSLGNSKATLNGALLMAPIWDRVQLEKRSISPADERVVILGGDDNSRK
AVQREFPFAKELYIEPNASIHRITGQLEALGSFDHIVWMSPSRVTECEVGDEMIEAQDQG
VIQMYRLIKAMLSLGYGQKEISWTIVTVNTQYVDQHDIVDPVDAGVHGLIGSMSKEYPNW
QTKLIDVKKYEDLPLSQLLSLPADQEGNTWAYRNKIWHKLRLIPVHNNQPVHTKYKHGGV
YVVIGGAGGIGEAWSEYMIRTYQAQIVWIGRRKKDAAIQSKLDRFARLGRAPYYIQADAA
NREELERAYETMKQTHREINGIIHSAIVLQDRSLMNMSEECFRNVLAAKVDVSVRMAQVF
RHEPLDFVLFFSSVQSFARASGQSNYAAGCSFKDAFAQRLSQVWPCTVAVMNWSYWGSIG
VVSSPDYQKRMAQAGIGSIEAPEAMEALELLLGGPLKQLVMMKMANETNDEAEQTEETIE
VYPETHGSAIQKLRSYHPGDNTKIQQLL
NT seq 16467 nt   +upstreamnt  +downstreamnt
atgaagcggcagttgaaaagcccgctttcagaagggcaaaaagggctgtggatgcttcaa
aaaatgtctcctgggatgagtgcatataacattcctttatgctttcgcttcagcaaacca
atacatgcagagacgttcaagaaagcccttctgtttgtacagagacaatatccggtctta
gccagtgtgattcaagaagaaaatggcattccatttcaatcggttcagttatcaaaggat
ctttattttgtggaagaggatatatcagcaatgaaatcagcagatattatgccttttcta
aaagaaaaagcaaaagaacctttccagttggaagctggtccgttatggcgcacacacctt
tttcatcggttagaagaatgcattgttcttataacaattcaccatatcatatttgatggt
gtgtcgatgctgacattgatatcggcgctattcgaagcgtatcaacaattgctgaatggg
attgaacccttgcagcagccatcaacagctgattattacgattttgtcgattgggaaaat
cgaatgctgactggcagagaaggggaagagcatctcgcttactggaaagaacagttgtct
gggagtctgccagttcttgatttgcctgctgaccgtccgcggtcttcagcacgaaaattt
aaggggcaagcttataaaagcttgctccctcatcacctgagaaatcaaattaaatcgttt
gcccgcaccaatcatgtgaatgaatcggttgtgtttctctccatttacaaagtgctgctg
catcattatacaaaacaaaaggatatcattgttggcgttccgacaatgggtcggcaagaa
gacagatttgaaaccctaatcggttattttatcaatatgatggctgttcggagcaagaat
atcggatctcagccattaacagcatttattcgggaactgcagctgacagtggctgtcggc
ctggatcatgcggcgtttccgttccctgcattggtaagagagctgaatgtagaccgctcg
gccgcggattctccggtttttcaaacagcttttctgtaccaaaacttttttcaggcaaca
ggcttgcaaaaagtgcttgaaccgtatcaaacgcttggcatcgaatatattgaagacatt
cggcaagagggtgaatttgagctggcgctcgaaatatatgagcaagaaaatgaaacagtg
cttcatcttctgtacaaccctgatttgtacgaactgtcctccattgaaagcatgatggag
aactatatgaagctcgcgcagcacatgatggaggacccgtctttgccgcttgaagcctac
tctttgcaattaaatcaagaacaaactagtttgctggaacaatggaatgcgacagggaca
aacatcgcaaatgacaagtgtatacatgaggtgtttgaggaaaaagcgaaacaaaccccc
gatgcggttgctgtgatgtttgaagacagatcacttacatataaagaagtagatgaaaaa
agcacatctgtggcagtctaccttcaacatcagggtgttagacctgaacagcccgttggc
atttgtgcagagcgttcgtttgatatgatcatcggaattttaggaatactgaaagctggc
ggagcgtatgtgccgttagatccaagttttccgcaagaacgattaaagtacatgctcaaa
gacagtcaggcatccattgtcctcacccaacctaacgttcatgataggatcagcggatta
actggcagccatgtaaaagcgatcaatatcgagttagcttgccgaaacggttatacagac
cagcaaagcagcggtttaaagcgggaagtaaaaccggaacacctcgcttatattatttat
acatcgggaagcaccggagagcctaaaggggttatggtagagcatcggagcattatgaat
accctgaattttcttgaatctcactatcctgtaacggctgaggatgcatatttattgaag
acgaactatgtgtttgatgtatcgatctcagaattattcggatggtttattggagatggc
cgtctagtgattcttccgcctaatggggagaaatcaccgcagctttgcatggattatatt
gaaacatataaagtgactcacattaattttgtgccggccatgctgcatgtttttttagaa
atggcgaaagacaacaagcgattcacagaggacggtccgctgaagtatatgatggttgca
ggtgaagccttccctaaagtattagtgaaaaaggcggtatcgctctttacaaactgccgt
gttgaaaatatatacggaccgacggaagcctccatttacgctgcgtatttcggatgcgga
aaaggagatatcgcaagtcaccatacaccgattggaaagcctgtttccaacacgaaaatt
tatattgtggaccagcatttgaagcctgtcccgatcggaaagccaggtgagctttgcatc
gctggagccggcttagcaagaggctactttaaaaagccggggcttacggctgaaaaattt
attgataatccctttgaatcagggacgaagctatataaatcgggtgattcagcaaggtgg
cttcctgacggcaacatagaatacttgggacggattgacagccaagtcaaaatacgcggt
tttcgcgtcgagctgggcgcaatagaaacaaagctgggtgaatttccgggcattttagat
caggcggtagtggtgaagcagcttgagggccatcaacagctcgctgcttattatacagag
gaaagcggacatgcctctgccaatccaaaagatttgcgccttcatctaaaatcgagtctg
cccgaatatatgataccttcacactttatccgcttagatgagcttccattatcgcccagc
ggaaaagtgaaccgtaaagaattagaaaaacgcgagatcgtgttcaacagaaggaaacca
aatcacttgcaattaacggaaatagaggatcaggtgctgcgcatttgggaggaaacgctc
aaggtcagcggatttgggccggaagacggatttttcgatgcgggcggcgattcgcttctg
gctgtagctgtggctgaacgaatcaaaaaagaattcgattgtgagtttcatgttactgag
ctgtttgagtattccacgatccgtgcaatcagtgaatacattttggagatgaaaaactca
gatctagccgggacacaaaatgaagatgatcatgatgacaaaaaagatggaaaatacccg
aaacagaagattcccccttattttgacgacagtgttgcgattgtggggatatcttgccag
ttcccgggtgcgaaaaatcatcatgacttctggaaccacatcaaagaaggcaaagaaagc
atacgattcttttctgaagaagagcttcgcgcaaatggagttcccgaagaattgatacag
catcctgactatgtgcctgtgcaatctgtgatcgaagggaaagacttattcgatcccggt
ttctttcaaatctcgccaaaagatgctgagtatatggaccctcagcttcgcctcttattg
ctgcactcctggaaagcgattgaagatgcaggatatgtggctaaggagattccggcaaca
agtgtatatatgtctgcaagcagcaattcatatagaacgttattgccgaaggagacaaca
gaaggacatgaatcaccggatggctatgtctcttgggttttagcccaaagcggaaccatt
cccacaatgatctcacataagctcggattaaaagggccaagctattttgttcattctaac
tgttcttcatcactagtcggtttatatcaagcatacaaaagcctgacatcgggcgaatca
caatatgcgcttgtcggaggcgcaacattgcacgcacaatcagcgatcggctacgtgcac
caaaacgggttgaatttttcaagcgacgggcatgtgaaggcgttcgatgcttcggcggac
ggaatggccggaggtgaaggcgtagcagtcatcctgctgaaaaaagctgtggatgccgta
aaagacggagaccatatttatgccattatgcgcggaataggcatcaataatgatggggca
gagaaggcaggcttctatgcgccaagtgtaaaaggccaaacagaagtgatacagcatgta
ttggatacaaccaagatccatcctgaaacggtcagttatattgaagcgcacgggacggga
acgaaattaggcgatcctattgaaatgtctgctctaaataaagtgtacaagcaatacacc
gacaaaacacaattttgcggaattggttcagtgaaaacgaatatcggccatttggataca
gctgcggggttagccggatgtattaaagttgcgatgagtttataccataatgaacttgca
ccgaccatcaactgtacggagccgaatccggatataaagtttgaaagctctcctttttat
gttgtccgtgaacgaaaatcgttagagaaacacgcaggtgtccatcgggcggctctgagc
tcattcggccttggcggaactaacgcccatgcaatatttgagcaatatgaaaacatttct
gatgcaggtgccgaaaacgaaggcaatcagccttacatcattcctatatcagcaaaaaat
agtgaacggctccaagtatacgcgaaggaaatgctgtcctatatcagtcaagacgagcaa
aggcatttctctttaagagatattgcatataccttccaagtcggccgtgaagcaatggat
aacaggatcgtttttatagtgaacgatctggaagagtggaaacatcagctggaagctttt
gtgactggaaagccgctcgcagaaggctgtattcaaggagaaaaaacgagaatgacatcc
gctgaacagctgcttggaaatgctgaagcagatgatatggcttcatcgcggatatcaaaa
gaagaattgagaaagcttgccgagatgtgggcaaatggctttcacgttgaatggcgcagg
ctctatccaaatataaagccacgccgcatcagcttgccgacatacccttttgccgaagaa
cgatactggcctgaaagcagcaccggcgctatcacaacaattgaaccatctcgtttgcat
cctttggtgcaccataatacatcggttctgtcagagcagcgtttcagctccattttcaca
ggacaagagtattttattgccgagcatatcattaaaggcatggcgattttgccggcggcg
gtcacgcttgaaatggcaagagccgctatagaacaaggaattggcggattggaggatcat
gaaactggaatcaggctgaaaaatgtcgtgtgggttcgcccggttgtagcaggaagtgag
ccggttcaggtaaatatcggactttacgatgaagatggcggacatattgcttatcggatg
tatggtgatccggaatccgctgatgcagaaccagttgtatataaccaaggtaaagcggaa
ttgattcagttaaagcgagaaaaagcactggatctttctaagatcaagaaacaatgtgat
caaagcaaaatggatgctgcctcgttttatgaagggatgatcggcgccgattacggtcca
ggttacaagagtgtagaggccgtatataaaggcgacggccagctgcttgccaaattatca
ctgccagaatctgttgcacatacgttgggcgattatgttcttcatccaagtgtaatggac
ggggcgttacaggcggctgaatatttgcaaaatgtcgtcagagcggaactttcagacact
gaagactttaaggcagcactgccatttgcactggaggaacttgaggtttttcgtcagtgc
gtttctgacatgtgggtttatgttcaattcaactcgaaaaacaaaccaggagatttgata
cagaaagtcgatattcacctatgtgatgagcatggcatgatctgtgtgcggctgaaagga
ttttcgacgagagtgatggaggcagatatacaaaccgaaccatcaaaaatcaacgctgaa
actttattgcttcagcccgtttggcaagaacaaaaggctgctaacagcttagctgcaaaa
aaatatgcagagcatctcgtattcctatgtgaatatgatcatgagacgagaaaacaaatt
gaagcagccatcgaggatgtccatgtatacagcctggaagcaaggccttcttcagtagat
gggcgtttccattcttatacagaacaagtgtttaaaaaggtacaagagatcattcgtacg
aaaccgaaagacggcattctcgttcagatcgtgacctctgccgagggagaacagcaattg
ttttcagggttgacaggactgctgaaaacagcttgtcaggaaaatgccaaactaaccggc
caaatgattgaagtcagcagtgaagaaagtggagaaagcattgctggcaaactgttagaa
aatcaaatgagcagcgattcatatgtcaaatatcaaaacgggacacggtatattgctgat
tggcgtgaaatcaaacaggcaaaaggagacggcagcaaaccgtggaaagacaatggcgtt
tatctcatttcaggaggtgccggcggactaggtcatatttttgcaaaggaaattgcggaa
caaacgaaaaatgcgacagtcattctggcgggccgctcacctcttagcgaaagcaaaagc
aaaaagctgaaagagcttcatagcaagggggctgacatcacctaccggcaaacagatgtt
accaataaaattgaagtctatcagctcattgacgacattcaaaaaagatatggccgtctg
aacggtattcttcatagtgccggaatcatcaaggacagctacctggttaataaacaggca
aaagatctgcacgatgtactggcgcctaaagtaaaagggcttgtttatctagacgaagcg
agtaaggatttgcctttagacttctttattctcttttcatctctttcaggaagtttaggg
agcattggtcagtctgactatgcggcagccaatgtatttatggatatgtatgcaggctat
cgaaataggcttgccgacctcagccagcggcatgggcagacgctttctgtaaactggcct
ttatggagagatggaggcatgcaggtcgatcaagaaactgagaaaaggcttgtgcaactt
gccggtattgttcctatgagggcggaaaaaggaattcaggcattatatcaagcacttcat
tcagaggcaaaccaagtaatggtgatcgaaggcgatgtgcagaaaataaaacaaaacatg
ctggccaaaaacgcctcagcacctatggaaaagaaggaagcagaacacatgactgaacaa
ataaatagcattgatgcagacagtttgctggataaagtaaaggcgatgttaaagcgagag
atcgccaagctgttaaaggtcaagcttgaaacgattgacgatcatgcagagatgacggtg
tatggttttgattctatctccatgactgaattcaccaaccatatcaatcgcgcctatcag
ttagagctgacgccaaccgtattttttgaccacccgacgattcatgcgtttggcaagcat
ttgtcagaagaatatcaatcggtatttgcgaagacatttgctgtgcgcgctgtatcggct
cagcttcagcctgctgcgaaacaggaacaagccgtgcgtgccaaagctaaaagacgcaga
aagcagcaagtcatgctgccaaacgccatacagagtgatgctgggcctgagccaattgcc
attgtgggcataagcgggattttccctatggcgaaagacgttgaggcgtactggaacatc
ttaaaagagggcaaagactgcatgacggaaatcccgaaagatcgctgggattggcgtgaa
tatgaaggtgatccggcgaaggaagtcaataaaacgaacgtgaaatggggcggttttatt
gacggtattgcagattttgatccattattctttggcatttccccgcgtgaagctgaacaa
atggaacctcagcagcgcttactgctgacttacgcctggaaagcgatcgaagatgcagga
tattcggcgaaaaggttgtcaggcacaaaaaccggcgtcttcatcggaacgggaaataca
ggatacagctctcttctatctaaagcgaactcggcaatagaaggatcagcggcagccaat
acgagcccatcggtcggtccgaaccgggtcagttatttccttaatctgcatgggccgagc
gaaccggttgatacagcgtgctcaagttcactagtggcgatccaccatgccatctcttca
attgaggaaggcacttgtgacatggcattagccggcggtgtaaatacgattatccttcct
gaggtgtatatcagctttgataaggcgggagcactgagcaaagaaggaaaatgcaagacg
ttttcaaatcaagccgatggttttgcacatggggaaggtgccggcatactgttcctgaaa
aaattaaaagcggctgaagaagcgggagaccatatttacggagtcataaaaggcagtgca
atcaatcacggcggccgtgcagcctctttaacgactcccaatccgaaggcgcaggcagat
gttattcagtcggcatatcaaaaagcgggaatcgacccgaaaaccgtgacctacattgaa
gcccacggaaccggaacggagcttggagacccggttgaaattaacggtttgaaatcagct
tttaaagcattgggtgtaaatgaaggagacacatcagccaatccttactgcggattaggg
tctgtaaagacaaacatcggccacttatcgctggcagccggtgcagcaggagttattaaa
atattattgcagcttaagcataaaaccttagtgaaaagtctgcattgcgaaaacgtgaat
ccatacattcagctgaaaaacagtccgttctatatcgtacgggaaacggaagaatggaaa
gcgctgaaaaatgaacagggagaagagcttcctcgacgggcaggtgtcagttcatttgga
atcggcggagtaaacgcccacgtgattatcgaggaatatattccggaagcatccgatgag
aatataccatccatcgcgccggaacatccgggtatcttcgttttatcggctaaaaatgaa
gcgcggctaaaagaacatgcacagcagctggcagatgcgcttgataagcaaacatatagt
gacgtaaatctcgcccgaatcgcttatacactgcaagccggacgggatgcgatggaagaa
cgtctcgggattatttccggttccattgaggatttacagaaaaagttaaaagactttgca
gcggagaaaagcggtgtggaggatgtatttaaaggcaggattgataaaggcacactccaa
atgctgacagaggacgaagagattcaagaagccgtcgagaaatggatggaacggggaaag
tatgcaaaattgcttgaattatgggtaaaagggcttgatgtagactggacgaaattgtat
ggcgagaatctgccaaagcgcatcagcttgccgacgtatcctttcgcaaaagaccgttat
tggatctctgatcatattgaaaaaagcggcagcattgatgcaaatcaagcagcctcccgc
cttggcggagccgtgctgcatccattaatgcatcaaaacacatccaatctctcggaacaa
aggtttagctctatttatacgggagaagagtttttccttgctgatcatgttgtgaaaggc
caacggattttgccgggagtggctcatcttgaattggcgcgggcagctgttgagcaggcc
gcagaggtacaaggtgtaccgcgcatcatgaagctaaagaatgcggtgtgggtgcggcct
attgttgtagaggatcagccgcagcaagtacacattaggcttttaccgggagaaaatggt
gagatctcttatgaaatctatggtcattcagacgttactggcgaacagtcaatcgtctac
agtcaaggcagcgcggtattgaatcctgctgaaaatttgccggcggttgatttgcaatct
ctgcgggagcagtgtcaggaaagtcatttcagcgtaaacgaagtatacgacacctatcga
atgattggatttgaatatggtcctgcttatcgcggagtgaaaaaaatctatacagctgaa
caatttgttttggcaaaattgtcattgcatccgtcagctgcagatacgctcagccaatac
aaaatgcaccctgggctgatggattctgctttgcaggcgtcaagcattttgacaggagcc
ggggataaccagctgacactgccttttgcggtccaggagcttgaagtcttcggagcatgt
tcgtcagaaatgtgggtatacgcaagatacagccaaggcagcaaggcaactgataaggtg
caaaagcgcgatatggatattttagatgagagcggcaatgtttgcgtacggatgaaagga
ttatctttcagagcagcagaaggcggctctggatcggcggaatctgatcaaacgctggca
accctgatgtttgaagaaaaatgggtgcccaaggattttaaaaaagaaagtcctgagcct
cattacgaacggcacattgtcatgctttgcgacatgaatggcctctcaaaagatcgcatt
gaatcaagaatgacaggagcggaatgcatcgttttggagtcattccgcgaaggacttgca
gagaggttccaagattatgccgaacaagcgcttgagacggtccagggtcttctcaaaagc
agacctcagggcaatgttctgatccagctgcttacctctgcacaaagaaagcagtactca
ttctcagggctatcggcgctccttaaaaccgccggcctggagaataaaaaactaatcggc
cagacgattgaaatcgattcacatgaaaatgttgaaagtgtaatagaaaaactgaaagag
aataaaaggcacacagaagatcagcacatcaaatatgaaaaaggcaaacggtacatcaat
gatctggatgaaatgcaaatagatgatcgggaaataagcatgccgtggagagataaaggt
gtatacctcatcacgggcggcgcaggaggacttgggtttatttttgcaaaagagattgct
cgccaagccgaacagcctgtgctcattctgacaggcagatccgcgttgaatgcggatcag
caggcggagcttaacgaacttcagcaattaggggctcgcgcagaatacaggcaggttgac
gtgacacaaacggaagcagcctccgagcttatcacaagcattacgtctgattacgaagac
ttgaatggtgtcattcacagcgctgggctgattaaagataactatcttatgagcaaaacc
aatgaagagctgacacaagttctcgctcctaaggtgaaagggcttgtgaatgtggatgag
gcaaccgagcatcttgcgttagatttctttatcctcttttcttcaatatcaagtgttgcc
ggcagcgcgggacaggccgattatgcaatggctaatgcatttatggacagttatgctgct
tatcggaatgcgcttgtaaccgccatgtacaggcacggacaaacgttgtcaatcaattgg
ccgctctggaaagaaggcggcatgcgcgcgaataaagaaattgaaaacatgacgttgaaa
aacacaggtgtgactccaatgcggaccgagaccggcattcaagcgctgtataaaggtttg
gcatttggcaaagatcaagtcatcgtcatggaaggattcaaagacatgatgagggaaaag
ctgactcaaaagccgtcttctgatgatgtaccaatgaaaacagtgcaagtacgggtgaca
tctgaagcaagaatggatcaagggaatatgtttgaccacattcaagaagttttaaagcaa
acaatctctcaattgctcaaaatcaaacctgaagagattgacccggacatggagtttaat
caatatggatttgattcgattacgttaactgaattcgcaaatacactgaatgagaagtgc
aagctggatcttacgcctacggtcttctttgagcacgcaactgtttatgcatttgcaggg
tatctgtcagaagaatatccaaatgcttttacagctcaaacgcctgccaaagctgaggtg
ctgatgcagcctgtcgaacagaatataaaaaatatgacgttttcgactgaaaaccgcttt
gtaaaaccttcggtaacaccaatgcaaaaggaagctgatcacaagcctgagcctattgcg
attgtggggatgagcggcgttttcccaaaggcaaaagacgttgaggaatattggaagaac
ctgtcatcgggcgcagattgtattacagaggttccaaaagaccgctgggattggcaggag
tattacggagaccctctgaaagaagcgaataaaacaaacgtcaaatggggcggttttatt
gatgaagttgctgactttgatccattgttcttcggcatatctccgctggaggctgagcag
atggagcctcagcagcgcctgttaatgacctatgcgtggaaggcggtagaagaagcggga
cactcagcgagaagcctggcaggaaccaaaacgggcatcttcatcgggacaggaaacaca
gggtacagttcacttctgtcaaatgtagacatcgaaggctcagcggctgcgaatatgagt
ccttctgcaggaccgaatagagtcagttatttcctgaacattcatgggccgagtgaaccg
atcgacactgcgtgctcaagctctttggtcgccattcatcatgcggtttgcgccattgaa
aatggaaactgtgaaatggcgattgcgggaggggtcaacacggtcgtaactccgcaaggc
catatcgcctatgataaagccggggcgctgagcaaagaaggaagatgcaaaacattttct
gacaaagccgatggattcgcagtcagtgaaggtgccggcattctctttctgaaaaagctg
acagcggctgaacgagacggtgatcatatttacggtgtcattaaaggaagtgcggtaaac
cacggtggccgcgcaaattctctaacgactcctaatccgaaagctcaggcggatgtcgta
aaaacagcatatgaaaaagcgggaattgatccaagaaccgtaacttatattgaagcgcat
gggactggaacagagctgggcgatccagtagaaatcaacggcttaaaagcggcatttaaa
gagctgtatgaaaaaacgggggacccggctgttcatggcagccattgcggacttgggtca
gcgaaaacaaacatcggtcacttatcactggcggccggtgtggctggtgtcattaaagtg
ttattgcagctcaagcataaaacgcttgtcaaaagtctgtacagtgaaactgttaatccg
tatatcagactggatgacagcccgttttatattgtgcaggaatcgagagagtggcaggcg
cttcgggatgaagccggccgagagctgccgcgccgcgcaggtatcagttcgttcgggata
ggcggcgtcaatgcccacgtggtcattgaggaatatattccgaaagaaacaacccatcct
gcaacagcaccagccgtgacagcacagcacccgggcatctttattttgtcggcaaaggat
gaagatcgtctgaaagaccaagcccggcaattagcagactttatcagcaagcgatctatc
actgctcgtgacctcactgatattgcttatacactccaagaggggcgtgatgcaatggag
gagagattagggatcatcgctgtctcgactggggacttgctggaaaaactgaacctcttt
atagaagggggcaccaatgcgaagtacatgtacagaggcagagcagaaaaaggtatcgca
caaacattgagatcagatgacgaagtacagaaaacgctcaacaatagctgggagcctcac
atatatgaaagactgcttgatttatgggtaaaaggcatggaaataggctggagtaaactg
tatgacggcaaacagccgaaacgcatcagcctccctacctatccatttgcgaaagaacgc
tactggataacggatacgaaagaggaggcagccgcccatcaaacagctttaaaaacagtc
gaatcagcagctttgcatccattgatacatgtcaacacatctgatttgtcagagcagcgt
ttcagctcggcctttacaggtgctgagttctttttcgccgatcataaggtgaagggaaaa
ccggttatgccgggcgtggcatatcttgagatggttcatgctgccgttacaagagcagtg
agaagaaccgaagatcaacaatctgttattcacatcaaaaatgttgtgtgggtgcagccg
attgtggcggatggccagcctgttcaagtggatatcagtctaaatccccagcaggacggc
gagattgcttttaacgtctatacagaggctgcacacaatgatcgaaagatacattgtcaa
ggcagtgcttcaatccgtggggcaggagacattccagtccaggatatcagcgcgcttcaa
gaccaatgcagtttaagcacactctcacacgaccagtgttatgaattgtttaaggcgatc
ggcattgactacggacctggttttcaagggatagatcggctttacatcggccgcaatcaa
gccttggcagagctttctctgcctgctggtgtaactcacacactgaatgaattcgttctt
catccaagtatggccgactctgctttacaagcgtcgatcgggctaaagctgaattccggt
gacgagcagctttctctgccttttgcgctgcaagagctagaaatattcagcccgtgtaca
aataaaatgtgggtgtctgtgacatctcgtcctaatgaggacaaaatacagagactggat
attgatttgtgtgatgaacaaggccgagtgtgtgtaagaatcaaggggattacctcaagg
ctgctggaagaaggcatacaaccgccagacgggccgacatcactaggaaactccaaagca
actcttaacggagcgcttcttatggcgccgatatgggatcgagtgcagctggagaagagg
agcatttcgcctgctgatgagcgtgttgtcatcctcggaggggatgacaacagcagaaaa
gctgttcaaagggagtttccgtttgccaaggagctgtacattgagccgaacgcatcaatt
catagaattacaggccagcttgaagcactcggatcgtttgaccacatcgtgtggatgtct
ccttctcgtgtgacagagtgcgaagtcggcgatgaaatgattgaagcccaagatcaaggc
gtcattcaaatgtataggctcattaaggcaatgctttctttaggctatggacagaaggag
ataagctggacgatcgtgacggtgaacacacaatatgttgatcagcatgatattgtcgac
ccggtcgatgccggggtgcacggcctgatcggttcaatgtcaaaagaatatccaaattgg
cagacaaagctgatcgatgttaaaaaatacgaagacctgccgttatctcaactcctttcc
ttgcctgccgatcaagaagggaatacgtgggcctatcgaaacaagatttggcataagctt
cgtctaattccagtacacaacaatcaaccggtgcacacgaagtataagcacggaggtgtt
tatgttgtcataggcggagctggcggtattggtgaggcgtggagtgaatatatgatcaga
acatatcaggcgcagatcgtttggattggcagaaggaaaaaggatgcagccattcaaagc
aagctggacagatttgcacgtctagggcgagccccgtattacattcaagcagatgcggct
aaccgagaggaattagaacgcgcgtatgaaacaatgaaacaaacacatcgtgaaatcaac
ggcatcatccattctgcaattgtcttacaagaccgaagcctgatgaatatgagtgaggaa
tgtttcagaaacgttcttgctgcaaaggttgatgtaagcgtgcgaatggctcaagttttc
cggcatgaaccactggattttgttttgtttttctcttccgtacaatcgtttgcaagagct
tccggacaaagcaattacgctgcgggttgcagttttaaggatgcttttgcacagcggctt
tctcaagtatggccttgtacagtagccgtgatgaattggagttattggggaagcattggt
gttgtttcatcaccggattaccaaaagagaatggctcaggcaggcataggctcaattgaa
gcccctgaagcaatggaagctttggaattgctgctcgggggaccgctgaagcagctagta
atgatgaaaatggcaaacgaaacgaatgatgaagcggaacagacagaagaaacgattgaa
gtgtacccggaaactcacggctccgccattcaaaagctgcgaagctatcacccgggtgac
aacacaaagattcaacaactgttatag

DBGET integrated database retrieval system