KEGG   Bacillus subtilis subsp. subtilis 168: BSU17220Help
Entry
BSU17220          CDS       T00010                                 

Gene name
pksR
Definition
(RefSeq) polyketide synthase PksR
  KO
K13615  polyketide synthase PksR
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bsu01004]
    BSU17220 (pksR)
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17220 (pksR)
Lipid biosynthesis proteins [BR:bsu01004]
 Polyketide synthase
  Modular PKS
   BSU17220 (pksR)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   trans-AT PKS
    Bacillaene PksX synthase
     BSU17220 (pksR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Thioesterase Ketoacyl-synt_C PP-binding PS-DH KAsynt_C_assoc Methyltransf_12 Methyltransf_11 Methyltransf_25 Thiolase_N Methyltransf_23 Methyltransf_31 Abhydrolase_6 Abhydrolase_1 DUF938 Methyltransf_16 Inhibitor_I48 MTS PCRF
Motif
Other DBs
NCBI-GeneID: 940036
NCBI-ProteinID: NP_389604
Pasteur: BG12654
BSORF: BG12654
UniProt: O31784
Structure
PDB: 

Position
1850890..1858521
Genome map
AA seq 2543 aa AA seqDB search
MLNTEDILCKMLFAQLQSIGFFTESKSQPVLENFYGRWFEESQSILERHQFLKRTENGHV
PTRSIGTMSELWKEWNEQKFDLLQDNNMKAMVTLVETALKALPEILTGKASATDILFPNS
SMDLVEGVYKNNQVADYFNDVLADTLTAYLQERLKQEPEAKIRILEIGAGTGGTSAAVFQ
KLKAWQTHIKEYCYTDLSKAFLMHAENKYGPDNPYLTYKRFNVEEPASEQHIDAGGYDAV
IAANVLHATKNIRQTLRNAKAVLKKNGLLLLNEISNHNIYSHLTFGLLEGWWLYEDPDLR
IPGCPGLYPDTWKMVLESEGFRYVSFMAEQSHQLGQQIIAAESNGVVRQKKRTEAEEDPS
HIQMNAEIDHSQESDSLIEQTAQFVKHTLAKSIKLSPERIHEDTTFEKYGIDSILQVNFI
RELEKVTGELPKTILFEHNNTKELVEYLVKGHENKLRTALLKEKTKPAKNEAPLQTERTD
PNKPFTFHTRRFVTEQEVTETQLANTEPLKIEKTSNLQGTHFNDSSTEDIAIIGVSGRYP
MSNSLEELWGHLIAGDNCITEAPESRWRTSLLKTLSKDPKKPANKKRYGGFLQDIEAFDH
QLFEVEQNRVMEMTPELRLCLETVWETFEDGGYTRTRLDKLRDDDGVGVFIGNMYNQYFW
NIPSLEQAVLSSNGGDWHIANRVSHFFNLTGPSIAVSSACSSSLNAIHLACESLKLKNCS
MAIAGGVNLTLDLSKYDSLERANLLGSGNQSKSFGTGNGLIPGEGVGAVLLKPLSKAMED
QDHIYAVIKSSFANHSGGRQMYTAPDPKQQAKLIVKSIQQSGIDPETIGYIESAANGSAL
GDPIEVIALTNAFQQYTNKKQFCAIGSVKSNLGHLEAASGISQLTKVLLQMKKGTLVPTI
NAMPVNPNIKLEHTAFYLQEQTEPWHRLNDPETGKQLPRRSMINSFGAGGAYANLIIEEY
METAPEKEHIAPRQQEFTAVFSAKTKWSLLSYLENMQLFLEKEASLDIEPVVQALHRRNH
NLEHRTAFTVASTQELIEKLKVFRTSRESSLQQGIYTSFDLQPCAESASRDREINAAEQW
AQGALIAFKEADIGNRTGWVHLPHYAFDHNTSFHFDVSSINEKSSDVEDNINQPVIQDQF
TYDEPYVQGHVFNNERVLVGATYGSLAIEAFFNLFPEENSGRISKLSYISPIVIKQGETI
ELQAKPLQKDQVIELQIMYREPSSGLWKPAAIGQCGIGSFEPKKVNIENVKHSLTKLHHI
DQMYKTGNGPEWGELFKTITHLYRDHKSILAKIRLPQSGLANGHHYTVSPLMTNSAYLAI
LSFLEQFDMTGGFLPFGINDIQFTKQTIKGDCWLLITLVKNTGDMLLFDVDVINESSETV
LHYSGYSLKQLRISNQRGNQNKAIKASNLKARIRSYVTDKLAVNMADPSKLSIAKAHIMD
FGIDSSQLVALTREMEAETKIELNPTLFFEYPTIQELIDFFADKHEASFAQLFGEAHQQE
ERPAQIENQMKQIPAYETNTDKTIEHAADGIAIIGMSGQFPKANSVTEFWDNLVQGKNCV
SEVPKERWDWRKYAAADKEGQSSLQWGGFIEGIGEFDPLFFGISPKEAANMDPQEFLLLI
HAWKAMEDAGLTGQVLSSRPTGVFVAAGNTDTAVVPSLIPNRISYALDVKGPSEYYEAAC
SSALVALHRAIQSIRNGECEQAIVGAVNLLLSPKGFIGFDSMGYLSEKGQAKSFQADANG
FVRSEGAGVLIIKPLQKAIEDSDHIYSVIKGSGVSHGGRGMSLHAPNPAGMKDAMLKAYQ
GAQIDPKTVTYIEAHGIASPLADAIEIEALKSGCSQLELELPQEVREEAPCYISSLKPSI
GHGELVSGMAALMKVSMAMKHQTIPGISGFSSLNDQVSLKGTRFRVTAENQQWRDLSDDA
GKKIPRRASINSYSFGGVNAHVILEEYIPLPKPPVSMSENGAHIVVLSAKNQDRLKAIAQ
QQLDYVNKQQELSLQDYAYTLQTGREEMEDRLALVVRSKEELVIGLQACLAEKGDKLKSS
VPVFSGNAENGSSDLEALLDGPLREMVIETLLSENNLEKIAFCWTKGVQIPWEKLYQGKG
ARRIPLPTYPFEKRSCWNGFQAVENTPSVSQDERINNSSDHHILANVLGMAPDELQFHKP
LQQYGFDSISCIQLLQQLQSKVDPLIVLTELQACHTVQDMMDLIAKKQEDTSLQNDQART
FPELIPLNDGKRGRPVFWFHGGVGGVEIYQQFAQKSQRPFYGIQARGFMTDSAPLHGIEQ
MASYYIEIIRSIQPEGPYDVGGYSLGGMIAYEVTRQLQSQGLAVKSMVMIDSPYRSETKE
NEASMKTSMLQTINTMLASIAKREKFTDVLISREEVDISLEDEEFLSELIDLAKERGLNK
PDKQIRAQAQQMMKTQRAYDLESYTVKPLPDPETVKCYYFRNKSRSFFGDLDTYFTLSNE
KEPFDQAAYWEEWERQIPHFHLVDVDSSNHFMILTEPKASTALLEFCEKLYSNRGVVNAN
FLKAFRKKHEAREEKETDELVKR
NT seq 7632 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacacagaagacattctctgtaaaatgcttttcgcacaattacagtccataggg
tttttcacagaaagtaaatcccagccggtattggagaatttctatggcagatggtttgaa
gaaagccaatcgattttagaacggcatcaatttctcaagcgaacggagaacggacatgtt
ccaacacgctcaataggcaccatgagcgagctgtggaaagaatggaatgaacaaaaattt
gacctgcttcaagacaataatatgaaagccatggtgacattggtggagacagcacttaaa
gccttgccggagattctgaccggcaaggcgtcagccaccgatatcctgtttccgaattca
tctatggatttagtagaaggggtctataaaaacaatcaagtcgcagactattttaatgat
gttcttgcagatacgttaacagcctatctgcaagaacgtctgaagcaagagcctgaggcg
aagattcgaatattagaaatcggagccgggaccggcgggacaagcgcggctgtttttcaa
aaattgaaagcatggcagacacatataaaagaatattgttatacagatctgtctaaagct
tttttaatgcatgcagaaaataagtatggtcctgacaatccatatttgacatataaacga
tttaatgtcgaggagccggcgtctgaacagcatattgatgcgggaggctacgacgcggtc
atcgcggcaaatgtgcttcatgccacaaaaaatatccggcagacattgcgaaatgcaaaa
gcagttttgaaaaaaaacgggctgctccttttaaatgaaataagtaatcataatatatat
tcgcatttgacgttcggccttttagagggctggtggctgtatgaggatcctgatctccgc
ataccgggctgcccgggcctgtatccagacacttggaaaatggtgcttgagagtgaagga
tttcgctatgtttcctttatggctgaacaatcgcatcaactcggccagcagatcattgcc
gctgaaagtaacggagtcgtccgtcaaaagaagagaacggaggcagaagaagatccaagc
catatacaaatgaatgctgaaatcgatcattcacaggaaagcgattctctcatcgaacaa
acggcacaatttgtgaagcatacgctggcaaaatcaatcaaactatcaccagaacgtatt
cacgaagatacgacatttgagaagtatggaattgattcgattttgcaggtgaatttcatt
cgtgaattagaaaaagtgacgggagagcttccaaaaaccattttatttgaacataacaac
acaaaagaactcgtcgaatatttagtaaaggggcatgaaaataagcttcggacagcattg
ttaaaggaaaaaacgaagcctgcaaaaaatgaagctccacttcaaacagagcgtacagat
cctaataagccatttacttttcatacacgccgctttgttacagagcaggaagtcacggaa
actcagctagcaaataccgaaccactaaaaatagaaaagacaagtaatttgcaaggaaca
cattttaatgattctagtacagaagatatcgcaataatcggggtaagcgggcgctatccg
atgtctaacagtttagaagagctttgggggcatttaatcgccggagacaattgtattaca
gaggcaccggaatccagatggcgcacatctttattgaaaacattatcaaaagatccaaaa
aagccggcaaataagaaacgctatggcggatttttacaagatatagaggcatttgaccat
cagctttttgaggtggagcaaaaccgggtgatggaaatgacaccggaactccgtttatgt
ttagaaaccgtctgggaaacgtttgaggacggcggctatacgcgaacccggctggataaa
ttgcgggatgatgacggagtaggtgtttttatagggaatatgtataaccagtatttttgg
aatatcccatctttagagcaggcagtcctcagctcaaatgggggagactggcacattgca
aatcgcgtttcccacttttttaacctgaccggaccgagtatcgctgtcagctcagcatgc
tctagttcattaaacgccatacatcttgcgtgtgaaagcctgaaattgaaaaactgctca
atggcgattgctggaggtgtcaatttaacactcgatctctctaaatatgattctttggag
cgtgccaatctgctgggaagcggcaatcaaagcaaaagttttggcaccggaaacgggctt
attcccggggaaggcgtcggagctgtcctgttaaaaccactttcgaaggcgatggaagat
caggatcatatttacgctgtgatcaaaagcagttttgctaaccatagcggcggaagacag
atgtatacagctccggacccgaagcagcaagcaaagttaattgtcaagtcgattcagcag
tcgggcattgatccagagactatcggctatattgaatcggcggcaaatggttcggcgctg
ggcgatcctattgaagtaattgccttaacaaacgcgtttcaacaatatacaaacaagaaa
cagttttgtgcgataggctctgtcaaatccaatctggggcatttagaggcggcttccggt
atttctcagctgacaaaagtgctgctgcagatgaagaaagggacgctggtgccgacaatt
aacgcgatgcctgtcaatccaaatattaagctggaacacacggctttctatcttcaggaa
caaacagagccatggcatcgcttgaatgatcctgaaactggaaaacaattgccgcgcaga
agcatgatcaattccttcggagcggggggagcctatgccaatcttattatagaagaatat
atggagacggcccctgagaaagaacatatcgctccccgccagcaggaattcactgccgtt
ttttcagccaaaacaaaatggagcctgcttagctatctagaaaatatgcaattgttttta
gagaaggaagcttctctggatattgaacccgttgtacaggctttacacaggagaaaccat
aatttagagcataggactgcatttacagtggcatcgactcaagagctgatcgaaaaacta
aaggtgttccgaacatcaagagaaagctcactccagcaaggcatctatacatcattcgat
ttacagccatgtgcggaatcagcatctagggatagagaaataaacgcagcagagcaatgg
gcacaaggggcattgattgcttttaaagaagctgatatagggaaccgaacaggctgggtt
catctgcctcactatgcatttgaccataatacatcatttcatttcgatgtatcgtctatc
aatgagaaatcgtcagatgttgaagacaatatcaatcagccggtcattcaagatcaattc
acttatgatgagccttacgttcaaggacacgtcttcaacaatgaacgggtgcttgtcggt
gccacatatggcagtctggccattgaagcattttttaacctgttccctgaggaaaacagc
ggccgtatcagcaaattaagttatatcagtccaattgtcatcaaacaaggcgagaccatt
gaacttcaggcaaagccgctgcaaaaagatcaagtcatagaactgcaaatcatgtatcgc
gagccgtcctctggtttgtggaagcctgccgcaatcggacaatgcggaatcggttctttt
gagcccaaaaaagtcaatatcgagaacgttaagcattcattaactaagcttcatcacatc
gatcagatgtataaaaccggaaacggtcctgaatggggagagttatttaagacaattact
catctctacagagatcacaagtctatactggcaaaaattcgcctgccccaaagcgggctg
gcaaacgggcaccattacactgtaagcccattgatgacaaacagcgcgtacttggctatc
ctcagtttcttagagcagtttgacatgacaggcggcttcctgccgtttggaatcaatgat
atccagtttacaaagcaaacgataaaaggggattgctggcttttgattacattggttaag
aatacaggtgacatgttgctgtttgatgtagatgtgatcaatgagtcgtcagaaacagtg
ctgcactactcgggctactcgcttaaacagcttcgtatttcgaatcaaagaggaaatcaa
aataaggccatcaaagccagcaatctgaaagctcgtatcagaagctatgtaacagataaa
ctggcagtaaacatggccgatccgtcaaaattgtcaattgcaaaagcgcatatcatggat
tttggaattgattcttctcaattggttgcactgacaagggagatggaagcagagacaaag
atcgaattaaatccgactctgttttttgaatatccgactattcaagagttaatcgacttt
tttgcggacaaacatgaagcatcttttgctcagctgtttggtgaagctcatcagcaggaa
gaacgcccagctcaaatcgaaaaccaaatgaaacagattccggcatacgagacgaacacg
gataaaacaatcgaacacgcggcagacggcatagccattatcggcatgtcgggacagttt
ccgaaagcaaacagcgtaacggaattttgggataaccttgtccaaggaaagaactgtgtc
tctgaagtgccgaaagaacgctgggactggcgcaaatatgccgcagccgataaggaaggg
caatcaagccttcaatggggcggttttatagaaggaataggtgagtttgatcccctgttt
tttggcatatcgcctaaagaagcggcgaatatggacccacaggagtttctgctcttgata
catgcatggaaggcgatggaagatgcaggcttaacagggcaggttttatccagccgcccg
acaggagtatttgtcgcagccggcaatacggatacagctgtggttccttccctaattcca
aaccgtatatcctatgcacttgatgtaaaagggccaagtgaatattatgaagctgcctgt
tcctcagctctagtggctttgcacagagctatacaatccattcgaaacggcgaatgtgag
caagccattgtcggggctgtgaatttgctgctttcaccaaaaggctttattggcttcgac
tcaatgggctatttgagtgagaaagggcaggccaaatcctttcaagcagatgcaaatggc
tttgtcagaagtgaaggagcaggagttctcatcattaaaccattgcaaaaagccattgaa
gattctgatcatatttattcggttattaaaggttcaggtgtatcgcatggcggcagggga
atgtcacttcacgcgccaaatccggccggcatgaaggatgcaatgctgaaggcttatcaa
ggagcgcaaattgatcccaaaacggtgacctatatagaagcgcatgggatcgcctctcca
ttggcagacgcgatagaaatagaggcgttaaagtcaggctgcagtcagctcgaattggaa
cttccacaggaagtacgggaggaagcgccatgttatatcagcagcttaaagccgagcatc
ggacacggtgaactcgtctcaggcatggctgctcttatgaaggtcagcatggcgatgaag
catcaaacaataccaggcatatccggattttcgtctttgaatgaccaggtgtcattaaag
ggcacccgtttccgagtgactgccgagaatcagcaatggagggatttaagtgacgatgca
ggcaaaaaaattccgcgcagagcgagtatcaacagctatagctttggaggcgtaaatgcg
cacgtcattttagaagaatatattcctttaccaaaaccaccggttagtatgagtgagaat
ggtgcccacattgtagttctttctgcaaagaatcaagacaggctaaaagcaattgctcaa
cagcagcttgactatgtgaataaacaacaagaactgtcattacaagattatgcttataca
cttcaaaccggccgagaggaaatggaagaccgcctggcgctcgtcgtccgcagtaaagaa
gaactggtaatcggcttgcaagcctgcttagcagaaaaaggcgataagctgaagagttct
gtacctgtctttagcggaaatgcagaaaatggctcgtcagatctcgaagccttgctggat
ggtccattaagagaaatggtgatcgagactttgttgtctgaaaacaaccttgaaaagatc
gcgttttgctggacaaaaggggtgcaaatcccatgggaaaagctttatcaaggaaaaggt
gcccgcagaataccgttgccaacctatccatttgaaaagagaagctgctggaacggcttt
caagcagtagagaatacgccttctgtttcacaggatgagcgtatcaacaacagcagcgat
catcacatattagcaaatgtactagggatggctccggatgaactgcagtttcataagcca
ttgcagcagtatggatttgattcaatttcttgcatacagttattacagcaattgcaatca
aaggtggaccctctcattgtcttgacggagcttcaagcatgccatactgttcaggacatg
atggacttgatcgcaaagaaacaggaggatacatccttacaaaatgatcaagctcgcacg
tttccggaattaataccgttaaatgacggcaagcgggggcgccctgtcttttggttccat
ggcggagtaggaggagttgaaatctatcagcaatttgcacaaaagagccagcgccctttt
tacggcattcaagccagaggattcatgactgattctgctcctttgcacggaattgaacaa
atggcttcctattatatagagatcattcgatccatacagcctgaaggtccttatgatgta
ggcggatattccttaggcgggatgattgcatatgaagtcactcgccagctgcaaagccaa
ggccttgctgtcaaaagcatggtgatgattgactccccatatcgttctgagacaaaagag
aatgaggcatctatgaaaacgtcaatgctgcaaacaattaatacgatgctggcatcgatt
gcgaaacgggaaaagtttacggatgttctcatcagccgtgaagaggtggacataagctta
gaggatgaagaattcctgtctgagttgattgacttggcaaaagaacgagggctaaacaaa
ccagataaacaaatacgtgcgcaggctcagcaaatgatgaaaacacagcgcgcctatgat
ttggagtcgtacactgttaagcctctccctgatcctgagacggtaaaatgttattatttc
cgcaacaaaagcaggtctttctttggtgatttagacacttatttcactttatcaaatgaa
aaagaaccgtttgatcaagctgcctattgggaggaatgggagcggcaaattcctcatttc
cacctggtggatgtcgattcaagcaaccacttcatgatattaaccgaaccgaaagcgtca
acagccctgttagaattttgcgaaaagctctattcaaacaggggagtagtgaatgcgaat
ttccttaaggctttccggaagaaacatgaagcgagggaagaaaaagaaacagatgaattg
gtgaagcgctga

DBGET integrated database retrieval system