KEGG   Bacillus subtilis subsp. subtilis 168: BSU17230
Entry
BSU17230          CDS       T00010                                 

Symbol
pksS
Name
(RefSeq) polyketide biosynthesis cytochrome P450 PksS
  KO
K15468  cytochrome P450 family 107 subfamily K polypeptide 1
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17230 (pksS)
   00199 Cytochrome P450 [BR:bsu00199]
    BSU17230 (pksS)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  Oxygenase
   BSU17230 (pksS)
Cytochrome P450 [BR:bsu00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BSU17230 (pksS)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 940046
NCBI-ProteinID: NP_389605
Pasteur: BG12655
BSORF: BG12655
UniProt: O31785 A0A6M3ZB16
Structure
PDB: 
4YZR

Position
complement(1858566..1859783)
AA seq 405 aa
MEKLMFHPHGKEFHHNPFSVLGRFREEEPIHRFELKRFGATYPAWLITRYDDCMAFLKDN
RITRDVKNVMNQEQIKMLNVSEDIDFVSDHMLAKDTPDHTRLRSLVHQAFTPRTIENLRG
SIEQIAEQLLDEMEKENKADIMKSFASPLPFIVISELMGIPKEDRSQFQIWTNAMVDTSE
GNRELTNQALREFKDYIAKLIHDRRIKPKDDLISKLVHAEENGSKLSEKELYSMLFLLVV
AGLETTVNLLGSGTLALLQHKKECEKLKQQPEMIATAVEELLRYTSPVVMMANRWAIEDF
TYKGHSIKRGDMIFIGIGSANRDPNFFENPEILNINRSPNRHISFGFGIHFCLGAPLARL
EGHIAFKALLKRFPDIELAVAPDDIQWRKNVFLRGLESLPVSLSK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggaaaaattgatgtttcatccgcatggtaaagagtttcatcacaatcctttttcagtt
ttaggacgatttagagaggaagagcccattcaccgatttgaattaaaacggttcggagcc
acatatccggcctggttaattacccgatacgatgattgtatggcctttttaaaagacaat
cgaattacaagagacgtaaaaaatgtgatgaaccaagaacaaatcaaaatgctcaacgtt
agtgaagatatcgattttgtatccgatcatatgctggcaaaagacacacctgaccatacc
cgcctgagatcacttgttcatcaagcatttactccccgaaccattgaaaatctgcgcggc
agcattgaacaaattgctgaacagcttttagatgaaatggaaaaagaaaataaagcggat
atcatgaaatccttcgcttcccctttgccttttattgttatatctgaattgatgggaatc
ccaaaagaagatcggtcacagtttcaaatctggaccaatgcgatggttgatacctctgaa
ggtaatagagagctgacaaatcaggcccttcgtgaatttaaagattatatcgctaagctg
atccatgacagaagaataaagccaaaagacgatttaatcagcaaacttgtgcatgctgag
gaaaacggcagcaagttaagcgaaaaagagctctattcgatgctgttcttgctcgttgta
gccggccttgaaacaactgttaacttactcggctcaggcaccctcgcattgctgcagcac
aagaaggaatgtgagaagctcaagcagcagcctgaaatgatcgctacagcggttgaagaa
ttgctgcgatacacctcacctgtcgttatgatggcaaatcggtgggccatcgaagacttt
acatataaggggcattcgatcaaaagaggagacatgatttttataggcatcggatctgcc
aatcgcgacccgaatttttttgagaaccccgaaatattaaatataaatcggtcgcctaat
agacatatttcttttggttttggcattcatttctgcttaggagcgcctcttgccaggctg
gaaggccacattgcatttaaagcacttttgaagagatttcctgatattgaacttgcggtt
gcacctgatgacattcaatggagaaaaaatgtctttttaagaggattagaaagtctccct
gtttcactttcaaaataa

DBGET integrated database retrieval system