KEGG   Bacillus subtilis subsp. subtilis 168: BSU17230
Entry
BSU17230          CDS       T00010                                 

Gene name
pksS
Definition
(RefSeq) polyketide biosynthesis cytochrome P450 PksS
  KO
K15468  cytochrome P450 PksS
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU17230 (pksS)
Polyketide biosynthesis proteins [BR:bsu01008]
 Polyketide tailoring proteins
  Oxygenase
   BSU17230 (pksS)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 940046
NCBI-ProteinID: NP_389605
Pasteur: BG12655
BSORF: BG12655
UniProt: O31785
Structure
PDB: 
4YZR

Position
complement(1858566..1859783)
AA seq 405 aa
MEKLMFHPHGKEFHHNPFSVLGRFREEEPIHRFELKRFGATYPAWLITRYDDCMAFLKDN
RITRDVKNVMNQEQIKMLNVSEDIDFVSDHMLAKDTPDHTRLRSLVHQAFTPRTIENLRG
SIEQIAEQLLDEMEKENKADIMKSFASPLPFIVISELMGIPKEDRSQFQIWTNAMVDTSE
GNRELTNQALREFKDYIAKLIHDRRIKPKDDLISKLVHAEENGSKLSEKELYSMLFLLVV
AGLETTVNLLGSGTLALLQHKKECEKLKQQPEMIATAVEELLRYTSPVVMMANRWAIEDF
TYKGHSIKRGDMIFIGIGSANRDPNFFENPEILNINRSPNRHISFGFGIHFCLGAPLARL
EGHIAFKALLKRFPDIELAVAPDDIQWRKNVFLRGLESLPVSLSK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggaaaaattgatgtttcatccgcatggtaaagagtttcatcacaatcctttttcagtt
ttaggacgatttagagaggaagagcccattcaccgatttgaattaaaacggttcggagcc
acatatccggcctggttaattacccgatacgatgattgtatggcctttttaaaagacaat
cgaattacaagagacgtaaaaaatgtgatgaaccaagaacaaatcaaaatgctcaacgtt
agtgaagatatcgattttgtatccgatcatatgctggcaaaagacacacctgaccatacc
cgcctgagatcacttgttcatcaagcatttactccccgaaccattgaaaatctgcgcggc
agcattgaacaaattgctgaacagcttttagatgaaatggaaaaagaaaataaagcggat
atcatgaaatccttcgcttcccctttgccttttattgttatatctgaattgatgggaatc
ccaaaagaagatcggtcacagtttcaaatctggaccaatgcgatggttgatacctctgaa
ggtaatagagagctgacaaatcaggcccttcgtgaatttaaagattatatcgctaagctg
atccatgacagaagaataaagccaaaagacgatttaatcagcaaacttgtgcatgctgag
gaaaacggcagcaagttaagcgaaaaagagctctattcgatgctgttcttgctcgttgta
gccggccttgaaacaactgttaacttactcggctcaggcaccctcgcattgctgcagcac
aagaaggaatgtgagaagctcaagcagcagcctgaaatgatcgctacagcggttgaagaa
ttgctgcgatacacctcacctgtcgttatgatggcaaatcggtgggccatcgaagacttt
acatataaggggcattcgatcaaaagaggagacatgatttttataggcatcggatctgcc
aatcgcgacccgaatttttttgagaaccccgaaatattaaatataaatcggtcgcctaat
agacatatttcttttggttttggcattcatttctgcttaggagcgcctcttgccaggctg
gaaggccacattgcatttaaagcacttttgaagagatttcctgatattgaacttgcggtt
gcacctgatgacattcaatggagaaaaaatgtctttttaagaggattagaaagtctccct
gtttcactttcaaaataa

DBGET integrated database retrieval system