KEGG   Bacillus subtilis subsp. subtilis 168: BSU17240
Entry
BSU17240          CDS       T00010                                 

Gene name
ymzB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 940041
NCBI-ProteinID: NP_389606
Pasteur: BG13435
BSORF: BG13435
UniProt: O31786
Position
complement(1860014..1860370)
AA seq 118 aa
MAHTNTQLSQWLESKVGQTLDIRKGELTHDEEISDLDQIVLHLQKVAIRSTNHPDDYVAK
EELVLEGEGTTFTEDGNVPLPQNAYEIPLLGELHIHQENEGLKVVTDRAVYTIDIQHS
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcacacacgaatacacagctttctcaatggctggaatcaaaagtcggccagacgctt
gatattagaaaaggtgaattgacccatgatgaagagatatcagacttggatcagattgtt
ctccaccttcaaaaagtggctatacgcagtacgaatcatcctgatgattatgttgcgaaa
gaagagcttgttttagaaggcgaaggaacaacattcactgaggacggaaacgtaccgctt
ccgcaaaatgcctatgagattcctttattaggtgagcttcatattcaccaagaaaacgaa
ggattgaaggtcgtaacagatcgtgcagtatatacaattgatatccagcacagctga

DBGET integrated database retrieval system