KEGG   Bacillus subtilis subsp. subtilis 168: BSU17250
Entry
BSU17250          CDS       T00010                                 

Gene name
ymaE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lactamase_B
Other DBs
NCBI-GeneID: 940045
NCBI-ProteinID: NP_389607
Pasteur: BG13413
BSORF: BG13413
UniProt: O31787
Position
complement(1860449..1861273)
AA seq 274 aa
MPYYICNTCGVQHAQTVDPPNSCLICEDERQYIHPDGQTWTTLEDMREKGNLQNILKKEE
EHLYSIKTEPEFAIGQTAHLIQHKGFNVLWDCMTYLDQKTIDQINELGGIQAIALSHPHY
YSTQVEWAEAFQAPIYIHEDDKEWVTRPSNHIHFWSGETLNMKPGLDLYRLGGHFKGGAV
LHWSKGNEGKGCLLTGDIITVAADRNWVSFMYSYPNLIPLPASKVEEIAAKVKPLQFNRL
YNAFSKVVKENADESVQRSAVRYIKALNSELFHT
NT seq 825 nt   +upstreamnt  +downstreamnt
gtgccatattatatctgcaatacatgcggtgtgcaacatgcacagactgtagatccgccc
aactcgtgtctgatttgcgaggatgaaagacagtatattcatcccgatggacaaacttgg
acaacccttgaagacatgcgtgagaaaggaaaccttcaaaacatccttaaaaaggaagaa
gagcatctttacagcatcaaaactgaaccagagtttgcgattggacaaacagcccatctt
attcagcataagggcttcaatgtgctgtgggattgcatgacatatcttgaccaaaagaca
attgaccaaatcaacgaattaggcggtattcaagccatcgccttgtctcatccacattat
tactctactcaggttgagtgggctgaagcgtttcaggcgccgatctatatccatgaggat
gataaagaatgggtgacaaggccaagcaatcacattcacttctggtcaggggaaacgctc
aatatgaagccgggactggacctttaccgactgggcggacattttaaaggcggtgctgtt
ttgcattggagcaagggcaatgaagggaaaggctgtctattgaccggagatatcattacg
gttgcggcggatcgaaactgggtcagctttatgtacagctacccaaatctcattcccctt
cccgcctccaaagttgaagaaatagcagccaaagtaaaaccgcttcaattcaaccggctt
tacaatgctttctctaaagttgtcaaagaaaatgccgacgaatcggtccagcgttctgcc
gtacgctatatcaaggcactcaacagcgaactgtttcatacataa

DBGET integrated database retrieval system