KEGG   Bacillus subtilis subsp. subtilis 168: BSU17260Help
Entry
BSU17260          CDS       T00010                                 

Gene name
aprX
Definition
(RefSeq) serine protease AprX
  KO
K17734  serine protease AprX [EC:3.4.21.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU17260 (aprX)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BSU17260 (aprX)
Peptidases and inhibitors [BR:bsu01002]
 Serine peptidases
  Family S8: subtilisin family
   BSU17260 (aprX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8
Motif
Other DBs
NCBI-GeneID: 940056
NCBI-ProteinID: NP_389608
Pasteur: BG12567
BSORF: BG12567
UniProt: O31788
Position
complement(1861384..1862712)
Genome map
AA seq 442 aa AA seqDB search
MFGYSMVQMVRANAHKLDWPLRETVLQLYKPFKWTPCFLHKFFETKLQNRKKMSVIIEFE
EGCHETGFQMAGEVLQKEKRSKLKSRFNKINCCSAEVTPSALHSLLSECSNIRKVYLNRE
VKALLDTATEASHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTE
PYDDNGHGTHCAGDVASSGASSSGQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI
QYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQT
IASPGVSEKVITVGALDDNNTASSDDDTVASFSSRGPTVYGKEKPDILAPGVNIISLRSP
NSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKW
KDEDPNIYGAGAVNAENSVPGQ
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggtactctatggtacaaatggtgagagcaaatgctcacaagctagattggccg
ttacgggaaaccgtattgcaactttacaagcccttcaaatggactccttgcttcttgcat
aaatttttcgaaaccaaattgcaaaacagaaaaaaaatgtcagtcattatcgaatttgag
gaaggctgtcacgagaccggctttcaaatggctggagaggtgctgcaaaaagaaaaacgc
agcaagctaaaaagccgcttcaacaaaatcaactgctgcagcgccgaggttactccttca
gcattacattcccttctctctgaatgcagcaatatccgtaaagtgtatttaaaccgcgaa
gtcaaagcgcttttagacacggcaaccgaagcaagccatgcgaaggaagtcgtcagaaac
gggcaaaccctgacaggaaaaggtgttactgtcgctgttgtcgatacaggaatctacccg
catcctgatctagaaggaagaattatcggattcgcggacatggtcaatcaaaaaacagag
ccgtacgatgataatggtcatggcacacactgtgcaggtgatgtcgcaagcagcggtgca
tcctcttccggtcaataccgcggacctgcaccggaagccaatctcatcggcgtaaaggta
ttaaacaagcagggttcaggaacgttagcagatattatagagggtgttgagtggtgtatt
caatacaatgaggacaaccccgatgaaccgattgatattatgagcatgtcgctcgggggc
gatgcccttagatatgatcatgaacaggaagatccgttagtcagagcggttgaggaagcg
tggagcgcagggattgtcgtctgtgtcgctgccggaaactcaggccctgattcgcagacc
attgcaagcccgggcgtgagcgaaaaggtgattacagtaggtgcgcttgacgataacaat
actgcaagcagcgatgatgatactgtcgcttccttctcaagccgcggcccgacagtatac
gggaaagaaaagcccgatattttagcgccgggtgttaatattatttcccttcgctctccg
aattcttatattgataagctccaaaagtcaagccgtgtagggtctcagtactttacaatg
tcaggaacctcgatggcaacaccgatttgcgcaggaatcgcagctttaattcttcagcaa
aacccggatcttacccctgatgaagtaaaagagcttttgaaaaacggcacggacaaatgg
aaagatgaagatccgaatatctacggagcgggcgctgtcaacgcagaaaattccgttccc
ggccaataa

DBGET integrated database retrieval system