KEGG   Bacillus subtilis subsp. subtilis 168: BSU17270
Entry
BSU17270          CDS       T00010                                 

Gene name
ymaC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Gamma_PGA_hydro
Other DBs
NCBI-GeneID: 940071
NCBI-ProteinID: NP_389609
Pasteur: BG13411
BSORF: BG13411
UniProt: O31789
Position
1863448..1864155
AA seq 235 aa
MRRFLLNVILVLAIVLFLRYVHYSLEPEPSNQPDTYSNFSSLAENESPADYDISYNEKKG
SKVLIMSPHGGRIEGGVSELVRYFNNEYSTYLFEGLKSHDNQTLHITSTNFDEPLAKKKI
KEHQYVVAFHGYKGENKNTLVGGTDRKRAKMIVRALERRGFSAELASSKSGLAGLNAENI
NNQGETGLSIQLEISREQREAFFDDFYYKNRKYTKNSEFYAYVSAIKGVLEKEYS
NT seq 708 nt   +upstreamnt  +downstreamnt
atgagaagatttttactaaatgtcatattagtcttagccattgtcttgttcttgagatat
gttcattactcattggaaccagaaccatcaaatcagccagatacatattcaaatttcagc
agcttggcagagaatgagagcccagccgattacgatatttcatataatgagaaaaaagga
agcaaagtcttaattatgtctccgcatggcggaagaattgaaggcggagtaagtgagctt
gtgcgttatttcaataatgaatactctacatacctatttgaagggttgaagtcccatgat
aaccaaacactgcacattacaagcaccaactttgatgagccattggcaaaaaagaaaatc
aaggagcatcaatatgtggtggcttttcacggatataaaggagagaacaagaataccctt
gtagggggaacagaccgaaagcgggcgaaaatgattgtgagagcccttgagcggagaggg
ttttccgctgagttagcgtcgtctaaaagcggtcttgctggattgaatgccgaaaacatt
aataaccaaggggaaacggggctaagtatccagctggaaatcagccgtgagcagagagaa
gcattttttgatgatttttattataaaaatagaaaatacacaaagaacagtgaattttat
gcttatgtcagtgcgatcaaaggtgtcctggaaaaagagtattcgtaa

DBGET integrated database retrieval system