KEGG   Bacillus subtilis subsp. subtilis 168: BSU17280Help
Entry
BSU17280          CDS       T00010                                 

Gene name
ymaD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OsmC
Motif
Other DBs
NCBI-GeneID: 940058
NCBI-ProteinID: NP_389610
Pasteur: BG13412
BSORF: BG13412
UniProt: O31790
Position
1864225..1864677
Genome map
AA seq 150 aa AA seqDB search
MADHHFYLKANWPGNRNDVGTIESGNLITSISIPKEMDGPGEGTNPDEMLLGAAATCYII
TLAAMMERSGLEKEDLQMESEGIVNVTKGVFTYKKIIHRPSVVLKHDASQDDVALAHKLC
KKAESSCMISRAIQGNVELQLEASVKLGGE
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcatcatttttatttaaaagcgaactggccgggtaaccgtaatgatgtcggt
acgatcgaaagcggaaacctgatcacatcgatttccattcctaaagaaatggatggcccg
ggagaagggaccaacccagatgaaatgcttctcggggcggcagcgacctgttacattatt
acacttgcagcgatgatggagagaagcgggctggaaaaagaagacttacagatggagtca
gaaggcattgtcaacgttacaaaaggagtctttacatacaaaaagatcattcaccgtccc
tctgtcgtgcttaaacatgatgcttcacaagacgacgtcgcattggcgcacaaactttgt
aaaaaagcggagtcgtcatgcatgatttcgcgtgcaattcaaggaaatgtcgagctgcag
cttgaagcctctgtgaaactgggtggagaataa

DBGET integrated database retrieval system