KEGG   Bacillus subtilis subsp. subtilis 168: BSU17290Help
Entry
BSU17290          CDS       T00010                                 

Gene name
ebrB
Definition
(RefSeq) multidrug resistance protein EbrB
  KO
K11815  multidrug resistance protein EbrB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU17290 (ebrB)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU17290 (ebrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res EamA EmrE UPF0060 TMEM234 Phage_holin_2_4
Motif
Other DBs
NCBI-GeneID: 940051
NCBI-ProteinID: NP_389611
Pasteur: BG12586
BSORF: BG12586
UniProt: P0CW82
Position
complement(1864691..1865044)
Genome map
AA seq 117 aa AA seqDB search
MRGLLYLALAIVSEVFGSTMLKLSEGFTQAWPIAGVIVGFLSAFTFLSFSLKTIDLSSAY
ATWSGVGTALTAIVGFLLFGETISLKGVFGLTLVIAGVVVLNQSKAHAEDKKQTACE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagaggattgctttatttggctctcgccattgtatctgaagtgtttgggagcacgatg
ttgaagctttcagaaggatttacacaagcctggcccattgccggagtcatagtcggattt
ctttctgcttttacgtttctaagcttttctttaaaaacaattgacttatcaagcgcgtat
gcaacatggtcgggcgttggtaccgcgcttacagcaattgtcgggtttttgctttttggc
gaaaccatcagtttaaaaggtgtattcggtctcacgcttgtcattgcaggcgtggtcgtg
ctaaatcaatcgaaagcccacgctgaagataaaaaacagacggcctgtgagtga

DBGET integrated database retrieval system