KEGG   Bacillus subtilis subsp. subtilis 168: BSU17300
Entry
BSU17300          CDS       T00010                                 

Gene name
ebrA
Definition
(RefSeq) multidrug resistance protein EbrA
  KO
K11814  multidrug resistance protein EbrA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU17300 (ebrA)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU17300 (ebrA)
SSDB
Motif
Pfam: Multi_Drug_Res EamA EmrE TMEM234
Other DBs
NCBI-GeneID: 940059
NCBI-ProteinID: NP_389612
Pasteur: BG12585
BSORF: BG12585
UniProt: P0CW80
Position
complement(1865058..1865375)
AA seq 105 aa
MLIGYIFLTIAICSESIGAAMLKVSDGFKKWKPSALVVIGYSLAFYMLSLTLNHIPLSLS
YATWSGAGTVLTTVIGVKWFKEDLNAKGLIGILLLLSGVVLLNWP
NT seq 318 nt   +upstreamnt  +downstreamnt
atgttgataggatatatattcctcacgattgccatatgttcggaatcgataggagcagcc
atgctgaaagtatctgatggcttcaaaaagtggaagccaagtgctttggtcgttattggc
tattccctcgccttttatatgctgtccctgactttaaaccatattcccctgagcctctcc
tatgcgacttggagcggggcaggcacggtgctgacgacagtgatcggagtaaaatggttc
aaggaagatctgaatgccaaagggcttatcgggattcttttattactatcaggggtcgtg
ttacttaattggccgtaa

DBGET integrated database retrieval system