KEGG   Bacillus subtilis subsp. subtilis 168: BSU17330
Entry
BSU17330          CDS       T00010                                 

Gene name
miaA
Definition
(RefSeq) tRNA dimethylallyltransferase
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU17330 (miaA)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU17330 (miaA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     BSU17330 (miaA)
Prenyltransferases [BR:bsu01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   BSU17330 (miaA)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BSU17330 (miaA)
 Prokaryotic type
    BSU17330 (miaA)
SSDB
Motif
Pfam: IPPT IPT AAA_33 AAA_18 AAA RuvB_N AAA_14 Hydin_ADK AAA_16
Other DBs
NCBI-GeneID: 940067
NCBI-ProteinID: NP_389615
Pasteur: BG12617
BSORF: BG12617
UniProt: O31795
Position
1866389..1867333
AA seq 314 aa
MNNTKQPVVILVGPTAVGKTNLSIQLAKSLNAEIISGDSMQIYKGMDIGTAKITEQEMEG
VPHHLIDILDPQDSFSTADYQSLVRNKISEIANRGKLPMIVGGTGLYIQSVLYDYTFTEE
ANDPVFRESMQMAAEREGADFLHAKLAAADPEAAAAIHPNNTRRVIRALEILHTSGKTMS
QHLKEQKRELLYNAVLIGLTMDRDTLYERINQRVDLMMQSGLLPEVKRLYDKNVRDCQSI
QAIGYKELYAYFDGFVTLSDAVEQLKQNSRRYAKRQLTWFRNKMQVTWFDMTPPVDMELK
KKEIFTHIAGKLEL
NT seq 945 nt   +upstreamnt  +downstreamnt
ttgaataatacgaagcagcccgttgtcattttagtcggaccgacggcagtggggaaaacc
aatttaagtattcagctagccaaatccttaaacgcggaaattatcagcggagattcgatg
cagatttataaagggatggatattggaacagctaaaattaccgaacaggagatggaggga
gtgccccatcatctgattgacattttagatccccaagactctttctctactgccgattat
caaagcttagtaagaaataaaatcagcgagattgcaaatagaggaaagcttccgatgatt
gtcggcggtacagggctttatatacaatctgtgctttacgattatacatttacggaagag
gcaaatgatcccgtgtttcgagagagcatgcaaatggctgctgagcgggaaggcgctgac
tttcttcatgccaaacttgctgcagcagatcccgaggcagcagctgcgattcatccgaat
aatacaagaagagtcattcgcgcactggaaattttacatacgtccggaaaaacgatgtcc
cagcatttgaaggaacaaaaacgagaacttctgtacaatgcagtgttaattggcctgaca
atggatagagacacgctttacgaaagaattaatcagcgggtcgatttgatgatgcagtca
ggccttcttccggaagtgaaacgcttatacgacaagaacgtgagagactgtcaatcaata
caggcgataggctataaagagctgtatgcatattttgacggttttgtgacactttccgat
gctgtcgaacagctaaagcagaactcgaggcggtatgcgaaacgccagctgacgtggttt
cgcaacaaaatgcaggtcacatggttcgatatgacaccgcctgttgatatggagctgaaa
aaaaaggaaattttcacacatatagcaggaaaactcgaactttaa

DBGET integrated database retrieval system