KEGG   Bacillus subtilis subsp. subtilis 168: BSU17340
Entry
BSU17340          CDS       T00010                                 

Gene name
hfq
Definition
(RefSeq) RNA-binding protein Hfq
  KO
K03666  host factor-I protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02024  Quorum sensing
bsu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BSU17340 (hfq)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BSU17340 (hfq)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bsu03019]
    BSU17340 (hfq)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU17340 (hfq)
Messenger RNA biogenesis [BR:bsu03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     BSU17340 (hfq)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    BSU17340 (hfq)
SSDB
Motif
Pfam: Hfq LSM
Other DBs
NCBI-GeneID: 940073
NCBI-ProteinID: NP_389616
Pasteur: BG13416
BSORF: BG13416
UniProt: O31796
Structure
PDB: 
3AHU 3HSB

Position
1867373..1867594
AA seq 73 aa
MKPINIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLESEGKQQLIYKHAIS
TFAPQKNVQLELE
NT seq 222 nt   +upstreamnt  +downstreamnt
atgaaaccgattaatattcaggatcagtttttgaatcaaatccggaaagaaaatacgtat
gtcactgtttttttgctgaacggctttcagttgcggggccaggtgaaaggctttgataac
tttaccgtattgttggaatcggaaggtaagcagcagcttatatataaacatgcgatctca
acgtttgcgccgcaaaaaaacgtccagcttgaactcgaatag

DBGET integrated database retrieval system