KEGG   Bacillus subtilis subsp. subtilis 168: BSU17350
Entry
BSU17350          CDS       T00010                                 

Gene name
ymzC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YmzC
Other DBs
NCBI-GeneID: 940085
NCBI-ProteinID: NP_389617
Pasteur: BG13436
BSORF: BG13436
UniProt: O31797
Structure
PDB: 
3KVP

Position
1867790..1868062
AA seq 90 aa
MFESEAELRRIRIALVWIAVFLLFGACGNQDTIIETDNGNSDYETPQPTSFPLEHNHFGV
MEDGYIKIYEYNESRNEVKLKKEYADDELE
NT seq 273 nt   +upstreamnt  +downstreamnt
ttgtttgaaagtgaagcagaactgagacgaatcaggattgcacttgtatggatagctgtc
tttttactgttcggggcgtgcgggaatcaagataccattattgaaacagacaacggcaat
tcagactatgaaacgcctcagcccacctcgtttccacttgaacataaccattttggcgtt
atggaggacggctatatcaaaatttatgagtataatgagtcccgcaatgaggtaaagctg
aagaaagaatacgcggatgatgagcttgaataa

DBGET integrated database retrieval system