KEGG   Bacillus subtilis subsp. subtilis 168: BSU17360
Entry
BSU17360          CDS       T00010                                 

Gene name
ymzA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: BetaGal_dom3
Other DBs
NCBI-GeneID: 940080
NCBI-ProteinID: NP_389618
Pasteur: BG13434
BSORF: BG13434
UniProt: O31798
Position
1868144..1868374
AA seq 76 aa
MKHKVIVNHWEEICEDDSCYEYGTSIIVNGKELIREASIITALKAVLEEIGADVEIEETV
ESEKCCDSLRKKNLDY
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaagcataaagtgatcgtgaatcattgggaagaaatttgcgaagatgattcttgctat
gaatacggaacaagtatcattgtgaacggaaaagaattaatcagagaagcgtcaattatc
actgctttgaaggcggttttagaagagatcggcgcggatgttgaaatagaagaaacagta
gagagcgaaaaatgctgtgatagcttaagaaaaaaaaatctagactactaa

DBGET integrated database retrieval system