KEGG   Bacillus subtilis subsp. subtilis 168: BSU17370
Entry
BSU17370          CDS       T00010                                 

Gene name
nrdI
Definition
(RefSeq) ribonucleotide reductase stimulatory protein NrdI
  KO
K03647  protein involved in ribonucleotide reduction
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99984 Nucleotide metabolism
    BSU17370 (nrdI)
SSDB
Motif
Pfam: Flavodoxin_NdrI Flavodoxin_1
Other DBs
NCBI-GeneID: 940075
NCBI-ProteinID: NP_389619
Pasteur: BG11426
BSORF: BG11426
UniProt: P50618
Structure
PDB: 
1RLJ

Position
1868617..1869009
AA seq 130 aa
MVQIIFDSKTGNVQRFVNKTGFQQIRKVDEMDHVDTPFVLVTYTTNFGQVPASTQSFLEK
YAHLLLGVAASGNKVWGDNFAKSADTISRQYQVPILHKFELSGTSKDVELFTQEVERVVT
KSSAKMDPVK
NT seq 393 nt   +upstreamnt  +downstreamnt
gtggtacaaatcatatttgattcgaaaacagggaatgttcagcggtttgtgaataaaaca
ggctttcagcagatacgcaaggtggacgaaatggaccacgtggacactccgtttgttttg
gtcacctacacgacaaacttcggccaggtaccggcatcaacacaatcatttctcgaaaaa
tacgcccatctcttattgggagtcgctgcgagcggcaacaaagtatggggcgataacttt
gcaaaaagcgccgataccatttcaagacaatatcaggtgccgatcttgcacaaatttgaa
ctcagcggcacatctaaagacgttgaattgtttactcaggaggtagaaagagttgtcaca
aaatcaagtgccaaaatggatccagttaaataa

DBGET integrated database retrieval system