KEGG   Bacillus subtilis subsp. subtilis 168: BSU17380
Entry
BSU17380          CDS       T00010                                 

Gene name
nrdE
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit alpha
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00240  Pyrimidine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU17380 (nrdE)
   00240 Pyrimidine metabolism
    BSU17380 (nrdE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU17380 (nrdE)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BSU17380 (nrdE)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU17380 (nrdE)
SSDB
Motif
Pfam: Ribonuc_red_lgC RNR_N Ribonuc_red_lgN Fib_succ_major
Other DBs
NCBI-GeneID: 940091
NCBI-ProteinID: NP_389620
Pasteur: BG11404
BSORF: BG11404
UniProt: P50620
Structure
PDB: 

Position
1868969..1871071
AA seq 700 aa
MSQNQVPKWIQLNNEIMIQKDGKFQFDKDKEAVHSYFVDYINQNTVFFHNLKEKLDYLVE
NQYYEEEFLSLYSFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYED
RISIVALFFANGDTEKAKEYVNLMINQEYQPSTPTFLNAGRKRRGELVSCFLLEVNDSLN
DISRAIDISMQLSKLGGGVSLNLSKLRAKGEAIKDVENATKGVVGVMKLLDNAFRYADQM
GQRQGSGAAYLNIFHRDINDFLDTKKISADEDVRVKTLSIGVVIPDKFVELAREDKAAYV
FYPHTIYKEYGQHMDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLRSESGYPYIMF
QDNVNKVHANNHISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGSLNILNVM
EHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGLGAMNLHGYLAQNGIAYE
SPEARDFANTFFMMVNFYSIQRSAEIAKEKGETFDQYEGSTYATGEYFDKYVSTDFSPKY
EKIANLFEGMHIPTTEDWKKLKAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMER
IEERTYGNSKTYYPMPGLASNNWFFYKEAYDMDMFKVVDMIATIQQHIDQGISFTLFLKD
TMTTRDLNRIDLYAHHRGIKTIYYARTKDTGQDSCLSCVV
NT seq 2103 nt   +upstreamnt  +downstreamnt
ttgtcacaaaatcaagtgccaaaatggatccagttaaataacgaaatcatgatccaaaaa
gatgggaaattccagtttgataaggataaagaagctgtacatagctattttgtagattat
atcaatcaaaacacagtcttctttcacaatttaaaagagaagctggattatttggttgaa
aaccaatactacgaagaggaattcttaagcctttattcttttgaagacattaaagaagtg
tttaagacagcttacgctaagaagtttcgttttccttccttcatgagtgcgtttaaattc
tataatgactatgctttgaaaacgaatgacaagaaaaaaatcctcgagcgttatgaggac
cggatctcaattgttgcgctgttcttcgctaacggcgacactgagaaagcaaaagaatat
gtaaacctgatgatcaatcaagaatatcagccgagcacaccgacatttttgaatgccggc
agaaaacgccgcggtgaacttgtgagctgcttcttgctcgaagttaatgattctttaaat
gacatttcaagagcaatcgatatctccatgcagctttctaagcttggtggcggggtttct
cttaacctgtccaagcttcgcgcgaaaggtgaagccattaaagatgttgagaatgcgaca
aaaggcgttgtaggcgtcatgaagcttcttgataacgcgttccgttacgctgaccaaatg
ggacaaagacaaggctccggcgcggcgtatttaaacattttccaccgcgatatcaatgat
tttcttgatacgaaaaagatttctgcggatgaagatgtgcgtgtcaaaacgctttcgatc
ggtgttgtcattccggataagttcgttgagcttgcacgcgaggacaaagcggcttatgta
ttctacccgcacacgatttataaagagtacggccagcacatggatgagatggacatgaac
gaaatgtacgacaagtttgtcgacaaccctcgggtgaaaaaggaaaaaatcaacccgcgg
aaactgcttgaaaaattggcgatgcttcgttctgaatcaggctatccatacatcatgttc
caagataacgtcaataaagtgcatgcgaataaccatatttccaaggtcaaattttctaac
ctttgctctgaagtgctgcaggcatctcaagtttcttcatacacagactatgatgaagaa
gatgaaatcggtctggatatttcctgcaacctgggttcgcttaacattctcaatgtcatg
gagcataaatcaatcgaaaagacagtcaagcttgcgacagactctttaacacacgtgtct
gaaacaacagacatccgtaatgcgcctgctgtaagacgggcaaacaaagcgatgaaatca
atcggcctcggtgctatgaaccttcacggctaccttgcgcaaaacggcattgcgtatgaa
agtccggaagcgcgtgactttgcaaacacgttctttatgatggtgaatttctactccatc
cagcgttctgcggaaatcgcaaaagagaagggcgaaacgtttgatcaatatgaaggatca
acctatgcgacaggtgaatacttcgacaaatacgtttcaactgatttctcaccgaaatac
gaaaaaatcgctaatctgtttgaaggtatgcatatcccgacgacagaggactggaaaaag
ctaaaagcatttgtcgctgaacacggtatgtatcacagctacagattatgcattgcgccg
acaggctctatctcatacgttcaatcaagcacggcgtctgttatgccgattatggaacgg
attgaagaacgaacatacggcaactcaaaaacgtactacccaatgcctgggcttgcatct
aataactggttcttctataaagaagcctacgatatggacatgttcaaggttgtggatatg
atcgccactatccagcagcacattgatcagggaatcagctttacattgttcttaaaagac
acaatgacgacccgagatttaaaccgaatcgatctgtatgcacatcatagaggaattaaa
accatttactatgcaagaacgaaagatactgggcaagacagctgcctttcttgtgttgtt
tga

DBGET integrated database retrieval system