KEGG   Bacillus subtilis subsp. subtilis 168: BSU17400
Entry
BSU17400          CDS       T00010                                 

Gene name
ymaB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 939453
NCBI-ProteinID: NP_389622
Pasteur: BG11427
BSORF: BG11427
UniProt: P50619
Position
1872128..1872748
AA seq 206 aa
MGKMDEMILVAPRDDVFKKESLTFQGVYSEDSRVAEIMAQIEAAYREMRRGDAEEDPRFK
QPIPYVVIKREDEVFLYERLAGGGESRLHNKLSLGFGGHMNAIEGAASFAEVLKLNTDRE
LEEELQINEEDKQAIVTLGLINDDENSVGKVHIGILSALQLKPGAQVEVKEKEQIAGKWM
KVSELKQDDIYNRLETWSQFVVDILE
NT seq 621 nt   +upstreamnt  +downstreamnt
atgggaaaaatggacgaaatgattttagttgccccgcgcgatgatgtgtttaaaaaagaa
agcttaaccttccagggcgtgtacagtgaagatagcagagtagcagaaatcatggctcag
attgaagcggcctatcgtgaaatgagaagaggggacgcagaagaagatccgcgtttcaag
cagccgataccttatgtcgtcattaagcgtgaagatgaagtttttctttacgagcggctg
gctggcggcggtgaatcacgtctgcacaacaagctttctctcggttttggcggccatatg
aacgccatcgaaggggcagcttcatttgctgaagtcttaaagctgaacacagaccgtgag
cttgaggaagaactgcaaataaatgaagaagataaacaggcgattgtcacactgggattg
atcaatgatgatgaaaacagtgttggcaaagtgcatatcggtattctttctgcgcttcaa
ttaaagcctggcgcacaagtggaagtgaaggagaaagaacaaattgcgggtaaatggatg
aaagtttctgaattaaaacaggatgatatctacaaccgtctggaaacatggtcacagttt
gttgttgatattcttgaataa

DBGET integrated database retrieval system